KEGG   Rattus norvegicus (rat): 361159
Entry
361159            CDS       T01003                                 

Gene name
Eri1, RGD1308378, Thex1
Definition
(RefSeq) exoribonuclease 1
  KO
K18416  3'-5' exoribonuclease 1 [EC:3.1.-.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361159 (Eri1)
   03036 Chromosome and associated proteins [BR:rno03036]
    361159 (Eri1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     361159 (Eri1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     361159 (Eri1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Gene silencing
   RNA interference (RNAi) pathway
    Other RNAi proteins
     361159 (Eri1)
SSDB
Motif
Pfam: RNase_T SAP SAP_new25
Other DBs
NCBI-GeneID: 361159
NCBI-ProteinID: NP_001014165
RGD: 1308378
Ensembl: ENSRNOG00000011448
UniProt: Q5FVR4
Position
16q12.2
AA seq 345 aa
MEDERGREHGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKDTDGSKFITSNGGDFSDP
VYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKNYYKKQKLMLKESNAVD
SYYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHSLEIEDTFQQYVRPEVNSQLSE
FCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYCILTDGSWDMSKFLNIQCQ
LSRLKYPSFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLGMDYDGRPHSGLDDSKNIAR
IAVRMLQDGCELRINEKLHGGQLMSVSSSLPVEGAPAPQMPHSRK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggaggacgagcggggccgggagcatggcggcgacgcggcgcagcagaagacgccgcgg
ccagagtgtgaggagtcccggccgctgagcgtggagaaaaagcagcgatgcagacttgat
ggcaaagacacagatggatctaagttcataacctccaatggcggtgacttcagtgacccg
gtttacaaagagattgcaatgacaaatggttgtatcaacaggatgagcaaggaggagctc
agagctaaactttcagaattcaagcttgaaacaagaggagtcaaggatgttctaaagaag
agactgaaaaactattacaagaagcagaagctgatgctgaaagaaagcaacgccgtggac
agttactatgactatatttgtattattgactttgaggccacctgtgaagaggggaaccca
gccgagttcctacatgaaattattgagtttcctgttgttctgttgaatacacacagctta
gagatcgaagacacgtttcagcagtatgtgagaccagaggtgaattctcagctttcagag
ttctgcattggtcttactggaattactcaggatcaggtagacagagccgatgctttccct
caggtcctgaaaaaagtaatcgagtggatgaagtcaaaggagttgggaactaagtacaaa
tactgcatattaacagatggttcctgggatatgagtaagttcttaaacatccagtgccaa
ctaagcagactcaagtacccttcttttgctaaaaagtggatcaatattcgcaagtcttac
ggaaacttttataaggttccaagaagccagaccaaactaacaataatgcttgaaaaatta
ggcatggattatgatgggcgacctcacagtggtcttgatgactctaagaacattgctaga
atagcggttcggatgcttcaggatggatgtgaacttcgaatcaatgaaaaactgcacgga
ggacagctaatgagtgtgtcctcatccttaccagtagagggcgctccagccccacagatg
ccgcatagtagaaagtaa

DBGET integrated database retrieval system