KEGG   Rattus norvegicus (rat): 361169Help
Entry
361169            CDS       T01003                                 

Gene name
Letm2, LETM2S
Definition
(RefSeq) leucine zipper and EF-hand containing transmembrane protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LETM1 SAP DUF2497 BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 361169
NCBI-ProteinID: NP_001012158
RGD: 1311220
Ensembl: ENSRNOG00000026180
UniProt: Q5PQQ5
Position
16q12.4
AA seq 459 aa AA seqDB search
MAFYSYNSFLAIFWTRLPGHSVHPPCSHFPPLAFFHLPDSHLRTAYMKNCGSRKYSYPGL
TGNNKVHPLRTRLPQKLHTTCWLQNHPGKPQPEQIPEEPKATDPQPTKDDQTEVAEGKWS
LRQKIIDEVKYYYNGFSLLWIDTKVAARIVWRLLHGQVLTRRERRRLLRTCADVFRLVPF
VVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKMMGAKLEIAKFLQETMTEMA
KRNRAKLDDDSSDSSQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLRRPQLVALC
KLLELQAFGTNNLLRFQLLMTLRSIKADDEVIAKEGVKALSVSELQAACRARGMRSLGLT
EEQLRQQLTEWLDLHLKENVPPSLLLLSRTFYLIDVKPKPIELPPSIETPKTNLGIPSSP
PPESKEDITDPAPQLNGTKILQAKSQETSQNSKANSKGA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggccttctacagttataattcattcttagctattttctggacaagattgcctggccat
tccgtgcaccctccctgctctcacttccctccacttgcatttttccacttgccagattct
catttgcgtacagcctatatgaaaaactgtggaagcaggaagtactcctaccctgggctc
acaggcaacaataaagtccatcccttacgaaccagactcccccaaaaactgcacacgact
tgctggctacaaaatcaccctggtaaacctcagccggagcaaatcccggaagagccaaag
gcgacagaccctcagcctaccaaagatgaccagaccgaggttgcagaaggaaagtggtcc
ttgagacagaaaatcatagatgaagttaaatactattacaatggattcagtttactttgg
attgacaccaaagtcgctgccagaatagtttggaggctgctgcacggacaggtgctaacc
agacgagagaggcgaaggctgttgagaacgtgcgctgatgtcttccgcttggtcccattc
gtggtgttcataattgtaccttttatggaattcttgataccagtgtttctgaagctcttc
ccagacatgttgccatcaacttttgaaagtgaatccaaaaaggaagaaaaacagaaaaag
atgatgggtgccaaattggaaatagcaaaattccttcaagagacgatgacagagatggcg
aagaggaaccgagccaagttggacgacgactcctccgattcctcacagctctcctcttat
gtaaaacaggtccaaacaggtcacaagccctccactaaggagatagttcgcttctccaaa
ctcttcgaggatcagttagccctggaacacttacgtcgaccccagctagtcgccctgtgt
aagctgctggagttgcaggccttcggcacaaacaatttgctccgcttccagctcctgatg
accctgaggtctataaaagcagatgatgaagtcattgccaaagaaggggtgaaggcttta
agtgtgtcagaacttcaggctgcgtgtcgggcccgggggatgaggtcgctgggcctcact
gaagaacaactgcgccagcagctcacagagtggctggacctccacttgaaggagaacgtc
cccccttctctcttgctcctgtcccgcaccttctacctgatagacgtgaagccaaagcct
attgaactcccacccagtatagagactccaaagacaaaccttgggataccgtcatctccg
ccccccgagtcaaaggaggacattacggaccctgcacctcagctaaatggaacgaagatc
ctccaggccaagtctcaggagacctcacagaacagcaaggctaattcaaaaggagcctaa

DBGET integrated database retrieval system