KEGG   Rattus norvegicus (rat): 361178
Entry
361178            CDS       T01003                                 

Gene name
Tfdp1
Definition
(RefSeq) transcription factor Dp-1
  KO
K04683  transcription factor Dp-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    361178 (Tfdp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    361178 (Tfdp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361178 (Tfdp1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, DP
    361178 (Tfdp1)
SSDB
Motif
Pfam: DP E2F_TDP
Other DBs
NCBI-GeneID: 361178
NCBI-ProteinID: NP_001020889
RGD: 1560344
Ensembl: ENSRNOG00000019222
UniProt: Q4KM53
Position
16
AA seq 290 aa
MKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMN
IISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSHLQELILQQIAFKNLVQRN
RQAEQQARRPPPPNSVIHLPFIIVNTSRKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVL
KRMGMACGLESGSCSAEDLKVARSLVPKALEPYVTEMAQGSIGGVFVTTTGSTSNGTRLS
ASDLSNGADGMLATSSNGSQYSGSRVETPVSYVGEDDDDDDDFNENDEED
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaaggtgtgtgagaaggtgcagaggaaagggacgacctcctacaatgaggtggccgac
gagctggttgccgagttcagcgccgctgacaaccacatcttacccaacgagtccgcctac
gaccagaagaacatccggcggcgtgtgtacgatgccttaaatgtgctgatggccatgaac
atcatctccaaggagaagaaggagatcaagtggatcggcctgcccaccaactctgctcag
gagtgccagaacttagaggtagagaggcagcggaggctggagaggatcaaacaaaagcag
tcacatctccaggagctcatcctgcagcaaattgccttcaagaacttggtgcagagaaat
cgccaagcggagcagcaggcccgcaggccaccgcctcccaactctgtcatccacttgccc
ttcatcattgtcaacaccagcaggaagacagtcatcgactgcagcatctccaatgacaaa
tttgagtatctgttcaactttgacaacacgtttgaaatccacgatgatatcgaggtgctc
aagcgcatgggcatggcctgtgggctggagtcgggcagctgctctgctgaagacctcaag
gtggcgagaagtctggtaccaaaagctctagaaccgtatgtgacagagatggctcaggga
tccattggcggagtatttgtcacgacaacaggttctacatccaatggcacaaggctttct
gccagtgatttgagcaatggtgcagatgggatgctggccacgagctccaatgggtctcag
tacagcggctccagggtggagacccctgtgtcctacgttggggaggatgacgacgacgac
gatgactttaatgagaacgacgaggaggattga

DBGET integrated database retrieval system