KEGG   Rattus norvegicus (rat): 361181Help
Entry
361181            CDS       T01003                                 

Gene name
Cul4a, RGD1563853
Definition
(RefSeq) cullin 4A
  KO
K10609  cullin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03420  Nucleotide excision repair
rno04120  Ubiquitin mediated proteolysis
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    361181 (Cul4a)
  09124 Replication and repair
   03420 Nucleotide excision repair
    361181 (Cul4a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    361181 (Cul4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361181 (Cul4a)
   03400 DNA repair and recombination proteins [BR:rno03400]
    361181 (Cul4a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361181 (Cul4a)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     361181 (Cul4a)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      361181 (Cul4a)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      361181 (Cul4a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   361181 (Cul4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW OSCP
Motif
Other DBs
NCBI-GeneID: 361181
NCBI-ProteinID: NP_001120773
RGD: 1563853
Ensembl: ENSRNOG00000019649
Vega: OTTRNOG00000002003
UniProt: B2RYJ3
Position
16q12.5
AA seq 759 aa AA seqDB search
MADEGPRKGSVSALMGRTNGLTKPAALASGPAKPGGTGGSRKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYKQLRQVCEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRN
HIISDRMVQSKTIDGILLLIGRERSGEAVDRSLLRSLLSMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQDREVPEYLNHVSKRLEEEADRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLEQLLDENRVPDLTQMYQLFSRVKGGQHALLQHWSEYIKTFGTTIVINPEKDKD
MVQDLLDFKDKVDHVVEVCFQRNERFINLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERILDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSAPGPIDLTVNILTMGYWPTYTPME
VHLPPEMVRLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNADF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDSPNQYHYVA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgagggccctcggaagggcagcgtctcggctctcatgggccgcaccaacggc
ctcaccaagcccgcggcgttggccagtggccccgccaaaccgggaggcacgggcggctcc
aggaagctggtcatcaagaacttccgagacaggccgcggctgcctgacaactacactcag
gacacgtggcggaagcttcacgaagcggtcaaggccatccagagcagcacatccatcagg
tacaacctggaggaactgtaccaggctgttgagaatctgtgctctcacaaagtctccccc
acgctctacaagcagctgcggcaggtctgtgaagaccatgtccaggcccagatcctcccc
ttcagagaagactcactagacagcgttttgtttctgaagaagattaacacatgctggcaa
gatcactgcagacaaatgatcatgatcagaagcatcttcctgtttctggaccgcacctac
gtcctccagaactccatgctgccttccatctgggacatgggcctagagctgtttaggaac
catatcatcagtgacaggatggtgcaaagcaagaccattgatgggatcctgctgctgatt
gggcgtgaacgaagtggtgaggctgtggacaggagtctgcttcgcagtctgttgagcatg
ctctcagatctccaggtctacaaagactcattcgaactgaagttcttggaagagactaac
tgtctgtacgctgctgaaggccagcggctgatgcaagacagggaggttccagaatacctt
aaccatgtgagtaaacgtctagaagaggaagcagaccgagtgatcacttacttagaccac
agcacacaaaaaccgttgattgcctgtgtggagaaacagttgttaggagaacatttgaca
gcaattcttcagaaagggcttgagcagctgctggatgagaacagggtgcccgacctcaca
cagatgtaccagctcttcagccgggtgaaagggggccagcacgcactgctgcagcactgg
agcgagtacatcaagacctttgggacaaccattgtcatcaatcctgagaaagacaaagac
atggtccaagacctgctggactttaaggacaaagtggaccacgtggtggaggtgtgcttc
cagaggaacgagcgcttcatcaacctgatgaaggagtcctttgagacgttcataaacaag
agaccaaacaagccggcagagctcattgccaagcacgtggattcaaagttacgagcaggc
aacaaggaagcaacagacgaggagctggagaggatcctggacaagatcatgattctgttc
cgattcatccacggtaaagatgtctttgaagcattttataagaaagacttagcaaaaagg
ctgctagtggggaagagcgcgtcggtggacgcggagaagtccatgctgtccaagctgaag
catgagtgtggagcagcttttaccagcaagctggagggcatgttcaaggacatggagctg
tccaaagacatcatggttcacttcaagcagcatatgcagaaccaaagtgcaccaggcccc
atcgacctcacggtgaacatcctcaccatgggctactggcctacatacacacccatggaa
gtgcacctccctccagagatggtcagacttcaggaagtattcaagacgttctacctgggc
aagcacagtggccggaagctgcagtggcagacgacgctgggacacgctgtgttgaaggcg
gactttaaggaggggaagaaggagttccaggtgtccctgttccagacgctcgtgctgctc
atgttcaacgagggcgacgggttcagcttcgaagaaatcaaaatggccaccggcatagag
gacagtgagttgcgaagaacactgcagtctctcgcctgtggtaaagcccgggtcctgatt
aaaagtcccaaagggaaggaggtggaagacggagataagttcatcttcaatgcagacttc
aaacacaagttgttcagaataaagatcaatcaaatccagatgaaggaaaccgttgaagaa
caggttagcaccacagagagagtgttccaggacagacagtaccagatcgacgctgctata
gtcagaataatgaaaatgaggaagacacttggtcataatcttctagtttctgaattatac
aatcagctgaaatttccagtaaagcctggagatttgaaaaagaggattgagtcacttata
gacagagactatatggaacgagacaaagacagtccaaatcagtaccactacgtggcgtga

DBGET integrated database retrieval system