KEGG   Rattus norvegicus (rat): 361195
Entry
361195            CDS       T01003                                 

Gene name
Cdc14b
Definition
(RefSeq) cell division cycle 14B
  KO
K06639  cell division cycle 14 [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    361195 (Cdc14b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    361195 (Cdc14b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     361195 (Cdc14b)
    3.1.3.48  protein-tyrosine-phosphatase
     361195 (Cdc14b)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   CDC14
    361195 (Cdc14b)
SSDB
Motif
Pfam: DSPn DSPc PTPlike_phytase Y_phosphatase CDKN3 Y_phosphatase3
Other DBs
NCBI-GeneID: 361195
NCBI-ProteinID: NP_001101874
RGD: 1311163
Ensembl: ENSRNOG00000018999
UniProt: F1M567
Position
17p14
AA seq 520 aa
MKRKSERRSAWATAPPCSRRSSSSSPGVKKSRSSTPQELHRLEQQDDLYLDITDRLCFAI
LYSRPKSASNEHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIH
FTGTDQRKQANAAFLIGCYMVIYLGRAPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLL
DCFHAVKKAIQYGFLNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGY
HQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAEAIVQEFL
DICENVEGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFL
VMKQSSLWLEGDYFRQKLRGQENGALREAFSKHLSDVDDISINGLENQDSQEPEPYSDDD
EVSGVTQGDRLRALKSRRQPKTNAIPLTVILQSSVQSSKTPEPNLSGSAGITKRTTRSAS
GKSSLKSLAPWRERRRRSALQHMPMLALCPAISRTKTVLR
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgaagcgtaagagcgagcggcgctcggcttgggccaccgcgcccccctgctcacgccgc
agctcgtcctcctctcccggtgtgaagaagagccgcagctccacgccgcaggagctgcac
cgcctggagcagcaggacgacctgtacctggacatcacggatcgcctttgttttgccatt
ctctacagcagaccaaagagtgcatcaaacgagcattatttcagcatagataacgagcta
gagtatgagaacttctatgcggattttggaccactcaatctggccatggtttacagatat
tgttgcaagataaataagaagctcaagtccattacaatgctgaggaagaaaattatccat
tttaccggcactgatcagagaaagcaagcgaatgccgccttccttatcgggtgttatatg
gttatatatttggggagggcaccagaagacgcgtatagaacattaatcttcggggataca
gcctatattcctttcagagatgctgcctatggaagctgcagtttctacattacacttctc
gactgttttcatgcagtaaaaaaggcaatccagtatggcttccttaatttcaactcattt
aacctcgatgaatatgaacactatgaaaaagcagaaaatggagatttcaactggataata
ccagagcggtttcttgccttctgtgggccacactcaagatccaggctggaaagtggttac
caccaacattctcctgagacttatattccatattttaagaatcacaatgtaactaccatt
atccgtctgaataaaaggatgtatgatgctaagcgctttacggatgctggattcgatcac
catgatcttttctttccggatggcagcacccctgctgaggcaattgtccaagaatttctg
gatatttgtgaaaatgtcgagggtgccattgcggtgcattgcaaagctggccttggtcga
acaggcacactgataggctgctacctcatgaaacattacaggatgacagcagccgagagc
attgcctggctcaggatctgtaggcccggctcagtgattgggccccagcaacagtttctg
gtcatgaagcaatcgagcctctggctggaaggcgactatttccgtcaaaagttgagaggg
caggagaacggagccctcagagaagccttctccaaacacctttcagatgttgatgacatt
tcgataaatgggcttgagaatcaagacagtcaagagcctgagccgtatagtgatgatgat
gaagtcagtggagtgacacaaggagacagacttcgggccctgaaaagccggagacagccg
aaaaccaacgctatccccctcacagtaattcttcagtccagtgttcagagctctaaaacc
cctgaacctaacctttctggcagtgcaggcattactaaacgaaccaccagatctgcttcg
ggaaaaagcagtcttaaaagcctggctccttggagggagaggaggaggaggagtgctttg
cagcacatgcccatgctggccttatgtccagccatttcaaggactaagacagtcttacgt
taa

DBGET integrated database retrieval system