KEGG   Rattus norvegicus (rat): 361207
Entry
361207            CDS       T01003                                 

Gene name
Tmed9, RGD1307627
Definition
(RefSeq) transmembrane p24 trafficking protein 9
  KO
K20346  p24 family protein alpha
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361207 (Tmed9)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    361207 (Tmed9)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    361207 (Tmed9)
Transporters [BR:rno02000]
 Other transporters
  Others
   361207 (Tmed9)
SSDB
Motif
Pfam: EMP24_GP25L YfcL
Other DBs
NCBI-GeneID: 361207
NCBI-ProteinID: NP_001009703
RGD: 1307627
Ensembl: ENSRNOG00000021882
UniProt: Q5I0E7
Position
17p14
AA seq 235 aa
MAAVRGVRVVGTSPGLLLGRGMRAFLLLLCLAARGGALYFHIGETEKKCFIEEIPDETMV
IGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQI
CLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQK
EQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV
NT seq 708 nt   +upstreamnt  +downstreamnt
atggctgcggtgcgaggcgtgcgagttgtcggaacctcacctggactcttgctggggaga
gggatgcgggccttcctgctactgctgtgccttgcagcccgcggaggcgcgctctatttc
cacataggagagacagagaagaagtgcttcattgaggagattccggacgagaccatggtc
atcggaaattaccggacgcagctgtatgacaaacagcgggaggagtaccagccagccact
cctgggcttggtatgttcgtggaagtaaaagaccccgaggacaaggtcattctggcccgg
cagtatggctctgagggcaggttcacattcacctcccacacccccggtgagcaccagatc
tgtcttcactcaaattctaccaagttctccctctttgctggagggatgctgagagttcac
cttgacatccaagtgggcgaacacgcgaacgactatgcggaaatcgcggccaaagacaag
ctgagtgagctgcagctgagagtccgacagctggtggagcaggtggagcagatccaaaag
gagcagaactaccagcggtggcgagaggagcgcttcagacaaaccagcgaaagcaccaac
cagcgagtgctgtggtggtccatcctacagactctcatcctcgtggccatcggcgtctgg
cagatgcggcacctcaagagcttttttgaagccaagaagttggtgtag

DBGET integrated database retrieval system