KEGG   Rattus norvegicus (rat): 361213Help
Entry
361213            CDS       T01003                                 

Gene name
Sptlc1, Lcb1, RGD1306617, Spt1
Definition
(RefSeq) serine palmitoyltransferase, long chain base subunit 1
  KO
K00654  serine palmitoyltransferase [EC:2.3.1.50]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
rno04071  Sphingolipid signaling pathway
Module
rno_M00094  Ceramide biosynthesis
rno_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    361213 (Sptlc1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    361213 (Sptlc1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rno01007]
    361213 (Sptlc1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.50  serine C-palmitoyltransferase
     361213 (Sptlc1)
Amino acid related enzymes [BR:rno01007]
 Aminotransferase (transaminase)
  Class II
   361213 (Sptlc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 361213
NCBI-ProteinID: NP_001101876
RGD: 1307140
Ensembl: ENSRNOG00000010882
UniProt: D4A2H2
Position
17p14
AA seq 473 aa AA seqDB search
MATVAEQWVLVEMVQALYEAPAYHLILEGILILWIIRLVFSKTYKLQERSDLTAKEKEEL
IEEWQPEPLVPPVSRNHPALNYNIVSGPPTHNIVVNGKECVNFASFNFLGLLANPRVKAA
AFASLKKYGVGTCGPRGFYGTFDVHLDLEERLAKFMKTEEAIIYSYGFSTIASAIPAYSK
RGDIVFVDSAACFAIQKGLQASRSDIKLFKHNDVADLERLLKEQEIEDQKNPRKARVTRR
FIVAEGLYMNTGTICPLPELVRLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGISIDDI
DLISANMENALASVGGFCCGRSFVVDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKKKCQTIHKSLQGVSGLKVVGESLCPALHLQLEESTGSRERDMKLLQEIVEQCM
NKGIALTQARYLDKEEKCLPPPSIRVVVTVEQTDEELQRAAATIREAAQAVLL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggtggcggagcagtgggtgctggtggagatggtgcaggcgctgtacgaggct
ccagcataccatctaattctggaaggaatcctcatactttggataatcagactcgttttc
tctaaaacttacaagttgcaggagcgttctgaccttacagccaaggaaaaggaagaactg
attgaagaatggcagccagagcccctcgtccccccggtctccaggaaccatcctgctctc
aactacaacatcgtctccggccctccaacccataacatcgtggtgaacggaaaagagtgt
gtcaactttgcctcctttaatttcctcgggttgctggccaaccctcgggttaaggctgcg
gcttttgcatcattaaagaagtacggcgtgggtacctgtggtcccagagggttttatggc
acatttgatgtccatctggatttggaagagcgcctggcaaagtttatgaagaccgaagaa
gctatcatttactcctatggcttctccaccatagccagtgcgattcctgcgtactctaag
agaggggacattgtttttgtggacagtgcagcctgctttgctatccagaaaggactacag
gcatcacgcagtgacattaagttattcaagcacaatgacgtagctgacctggagcgactg
ctaaaagaacaagagattgaagatcaaaagaatcctcgaaaggcccgtgtgactcggcga
ttcatcgtcgcggaaggattgtatatgaacactggaaccatctgccctcttccagaactg
gtgaggttaaagtataaatacaaagcaaggatcttcctggaggagagcctgtcgttcgga
gtccttggggagcatgggcgaggagtcaccgagcactatgggatcagtattgacgacatc
gaccttatcagtgctaacatggagaatgcgctcgcttctgttgggggcttctgctgtggc
cgctctttcgtggttgaccatcagcggctctctggccaaggatactgcttttcagcttca
ctgccccccctgctagccgctgccgccattgaggccctcaacatcatggaggagaaccca
gggatttttgcagttttaaagaaaaagtgccagaccatccacaagtccctacaaggggtt
tccggtttaaaagtggtgggggagtccctttgcccagcgcttcacctccagctggaagag
agcacgggctctcgggagagagatatgaagctgcttcaggagattgtagagcaatgcatg
aataagggcatcgcattgactcaggcacgctacttggacaaggaagagaagtgccttcct
cctccaagcatcagggttgtggtcaccgtggagcagacagacgaagagctgcagagggct
gcagccaccatcagggaggcggcccaggctgtgcttttgtag

DBGET integrated database retrieval system