KEGG   Rattus norvegicus (rat): 361232Help
Entry
361232            CDS       T01003                                 

Gene name
Pak1ip1
Definition
(RefSeq) PAK1 interacting protein 1
  KO
K14830  protein MAK11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:rno03009]
    361232 (Pak1ip1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    361232 (Pak1ip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 eIF2A WD40_like BBS2_Mid
Motif
Other DBs
NCBI-GeneID: 361232
NCBI-ProteinID: NP_001032433
RGD: 1565353
Ensembl: ENSRNOG00000023799
UniProt: Q32PZ0
Position
17p13
AA seq 382 aa AA seqDB search
MELVAGSYEQVLFGFTVHRGPAKSGHRETWTPVADFTHHAHTASLSAVAANNRYVVTGSK
DETIHIYDMKKKVEHGALVHHSGTVTCLKFYGSRHLISGAEDGLICVWDAKKWECLKSIK
AHRGHVTFLSIHPSGKLALSVGTDKTLRTWNLVEGRSAFIKNIKQNAHIVEWSPNGEKYV
VVVMNKVDVYHLDTASVSGTLTNGKRISAITFLSDSVLAVAGDEEVVRFFDCDTLVCLCE
FKAHENRVKDMVSFEIPDHHVLVTASNDGFIKMWTLTQDKKAPPSLLCETNTGARLTCLG
VWLDRGTDEKARLPPATEPCPDQPKTIEKESADKIQEEASAPNAEKSDHTGGSQQPTKRN
SPAPAKKRKMANVSEKKRKKKM
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggagctggtcgctggcagctacgagcaggtcctctttgggtttacagtgcaccgcggg
cccgcgaagagtggccaccgggagacatggactcctgtggctgacttcactcaccatgcg
cacactgcctccctgtcagcggtggcagccaacaatcgctatgtggtcactggcagcaaa
gatgagaccattcacatttatgacatgaaaaagaaggtagagcatggggctctggtgcat
cacagtggcacagtaacttgcctgaaattctatggcagccggcacttaatcagtggagca
gaagatgggctcatctgtgtctgggatgcaaagaaatgggagtgcctgaagtccattaaa
gctcacaggggacatgtgactttcctttctatccacccgtctggcaagttggctctgtct
gttggtactgataagacattaagaacgtggaatcttgtagagggaagatcagctttcata
aaaaatataaagcaaaatgctcacatagtggagtggtccccaaacggagagaagtacgta
gttgttgtgatgaataaagtggatgtctatcatctggacacggcgtctgtgagcggcacc
ctcacaaatggaaagaggatctctgccattacgtttctctcagactctgtccttgcagtg
gctggagatgaagaagttgtaaggttttttgactgtgataccctagtgtgcctctgtgaa
tttaaagctcatgaaaacagggtaaaagacatggtcagttttgaaatcccagaccatcat
gttcttgtcacagcatcaaatgatggcttcatcaaaatgtggacacttacgcaggataag
aaagctcccccatctctgctctgtgagaccaacactggtgccaggctgacgtgtcttggc
gtgtggttagaccgagggacagatgagaaggcgcgcctccctccagcaacagagccctgc
cctgaccaacctaagacgatcgaaaaggagtctgctgacaaaattcaggaagaagcgtca
gcacctaatgcagagaaatctgaccacactggtggcagccagcagccaactaaaagaaat
agcccagcgccagccaagaagaggaaaatggcaaacgtgtcagaaaagaagagaaaaaag
aaaatgtga

DBGET integrated database retrieval system