KEGG   Rattus norvegicus (rat): 361251
Entry
361251            CDS       T01003                                 

Gene name
Elmo1
Definition
(RefSeq) engulfment and cell motility protein 1
  KO
K12366  engulfment and cell motility protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    361251 (Elmo1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    361251 (Elmo1)
   05135 Yersinia infection
    361251 (Elmo1)
   05100 Bacterial invasion of epithelial cells
    361251 (Elmo1)
SSDB
Motif
Pfam: DUF3361 ELMO_CED12 PH_12 FERM_N ZFYVE21_C Imm42
Other DBs
NCBI-GeneID: 361251
NCBI-ProteinID: NP_001101885
RGD: 1308182
Ensembl: ENSRNOG00000059705
UniProt: D3ZY46
Position
17
AA seq 727 aa
MPPPSDIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGTDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRYIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgccgccgccttcggacatcgtgaaggtggccatagaatggcctggcgcctaccctaaa
ctcatggagattgaccagaaaaaaccactgtctgccataataaaggaagtctgcgatggg
tggtctcttgccaaccatgaatattttgctctgcagcatgctgatagttcaaacttctac
atcacagaaaagaatcgcaacgaaataaaaaatggcactattcttcgattaaccacgtcc
ccagctcaaaatgcccagcagctccatgaacgaatacagtcatcaagtatggacgccaag
ttggaagccctgaaggacttggccagcctctcccgggatgttacctttgctcaggagttc
ataaacctggatggcatttcactcctcactcagatggtggaaagtggcactgaacgatac
cagaagttgcagaagattatgaagccctgctttggagacatgctgtccttcactctcaca
gcctttgtggagctgatggaccatggcatcgtgtcatgggatacattctcagtggcgttc
attaagaagatagcaagctttgtgaacaagtctgccatagacatctcaatcctgcagcgg
tccttggccattttggagtcaatggttctcaatagccatgacctctaccaaaaggtagct
caggagatcaccattggccaactcattcctcatcttcaggggacagaccaagaaatccag
acttacaccattgctgtaatcaatgcacttttcctgaaagcgcctgatgagaggagacag
gagatggctaatattttggctcagaagcagctgcgctacatcattttaacccatgtcatc
cgagcacagcgggccatcaacaacgagatggcacaccagttatatgttctccaagtgctg
acctttaaccttctggaagataggatgatgaccaagatggacccccaggaccaggcccaa
agggacatcatatttgaacttcgaaggattgcttttgatgcagagtcagaaccgaataat
agcagcggcagcatggagaaacgcaagtccatgtacactcgggattataaaaaacttggc
ttcattaatcatgtcaatcctgccatggactttacacagacccctcccgggatgctggct
ctggacaacatgctgtatttcgctaagcaccaccaggatgcatacatccggattgtgctt
gagaacagcagccgagaagataagcatgaatgtccttttggacgcagcagtatagaactg
accaagatgctgtgtgagatcctgaaagtgggcgagctgcctagtgagacctgcaacgac
tttcacccgatgttcttcacccatgacagatcttttgaagagtttttctgcatttgtatc
cagctcctgaacaaaacatggaaggaaatgagggcaacatctgaagacttcaacaaggta
atgcaggtggtgaaggagcaggttatgagagcgcttacaaccaagcctagctccctggac
cagttcaagagcaagctgcaaaacctgagctacactgagatcctgaaaatccgccagtct
gagaggatgaaccaggaagatttccagtctcgcccgattttggaactaaaggagaagatc
cagccagaaatcttagagctgattaaacagcagcgtctgaatcgccttgtggaagggacc
tgctttaggaaactcaatgctcgtcggagacaagataagttttggtattgtcggctttca
ccaaatcacaaggtcttacattatggtgacttggaagagagcccccaaggagaagtgccc
catgattccctgcaggacaaattgccggtggcagatatcaaagcagtggtgacgggaaag
gactgcccgcatatgaaagagaaaggtgcccttaaacaaaacaaggaggtgcttgaactt
gctttctccatcttatatgactcaaattgccaactgaattttattgctcctgacaagcat
gagtactgcatctggacagatgggctgaatgcactgcttgggaaggacatgatgagtgac
ctgacacgaaatgacctggacaccctgctgagcatggagatcaagcttcgcctactggac
ctggaaaacatccagattccggatgcacctccccccatccccaaggagcctagcaactat
gactttgtttatgactgtaactga

DBGET integrated database retrieval system