KEGG   Rattus norvegicus (rat): 361255Help
Entry
361255            CDS       T01003                                 

Gene name
Tbce
Definition
(RefSeq) tubulin folding cofactor E
  KO
K21768  tubulin-specific chaperone E
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361255 (Tbce)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     361255 (Tbce)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP_GLY LRR_4 LRR_9 LRR_8 Ubiquitin_2
Motif
Other DBs
NCBI-GeneID: 361255
NCBI-ProteinID: NP_001012161
RGD: 1305533
Ensembl: ENSRNOG00000029667
UniProt: Q5FVQ9
Position
17q12.1
AA seq 524 aa AA seqDB search
MSDILPLDVIGRRVEVNGEYATVRFCGAVPPVAGLWLGVEWDNPERGKHDGSHEGTMYFK
CRHPTGGSFVRPNIVNFGEDFLTALKKRYVLTDGPDDDEKSCSLKVGSKQVQTIGFEHIT
KKQSQLRSLQDISLWKCAVSCAGERGRIAEACPNIRVVDLSKNLLSTWDEVILIAEQLKD
LEALDLSENKLQFPSDSPTLTRTFSTLKTLVLNKTGITWTEVLHCAPSWPVLQELYLKSN
GISISERPVNALQNLRLLDLSSNPSIDESQLCLIAYLPRLEHLLLSDIGLSSIHFPDAEI
GCKTSMFPALTYLIVNDNQISEWSFINELDKLQSLQALSCARNPLTKGDKAEEIIIAKIG
QLKTLNRCQILPEERRGAELDYRKAFGKEWRKAGGHPDPDRNRPSAEFLSAHPRYQLLCC
KYGAPEDEELKTQQPFMLKNQLLTLKIKCSNQPEQQILEKQLPDSMTIQKVKGLLSRLLK
VPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLVRW
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacatcttgccattagatgtcattggtagaagagttgaagttaacggagaatac
gcaacagtgcgcttttgtggtgctgttcctcctgtggcaggactctggttaggagttgag
tgggacaatcctgagagaggaaagcatgatgggagccacgaaggtactatgtattttaaa
tgcaggcacccaacaggaggctctttcgttcgtccaaacatagttaattttggagaagac
tttcttactgcccttaagaagcgctatgtgctcacagatggacctgatgatgatgaaaaa
tcgtgttccttaaaagtcggaagtaaacaagtgcaaactattggatttgagcatattaca
aagaagcagagtcagctgagatcactgcaggacatttccctgtggaagtgtgccgtgagt
tgtgctggtgaacgaggaagaattgctgaagcctgccccaatattcgagttgtagattta
tccaaaaacttgttgtcaacttgggatgaagtgattcttattgcagagcagctcaaagac
ctggaggctctggatctcagtgaaaataaactgcagtttccctctgactcaccaactcta
actagaacattttctactctgaagactttagtcctgaacaaaacaggaataacgtggact
gaggtgctgcactgtgccccttcatggccagtcctccaggaactttacctcaagtctaac
ggtatttccatttcagaaaggccagtgaatgccctgcagaacctgaggttactagacctt
tcttccaacccatcaattgatgaaagccagctgtgcctgatagcatatctcccaagatta
gaacacctactcctttctgacattggactttcttctatacattttccagatgctgaaatt
gggtgcaaaacatccatgttcccggccttgacgtacctcatagtcaatgacaaccagata
tcagaatggtcatttatcaatgagctggataaattacagagcctgcaggccctgtcctgt
gctagaaaccctttgaccaaaggagacaaagcagaggagatcatcattgccaagattggt
cagctgaagaccctgaacaggtgtcagattcttccagaggaaaggcgtggtgctgagctt
gattatcgaaaagcctttggaaaagaatggagaaaggctggtggacacccagatccagac
agaaacaggccaagtgcagagtttctctcggcccatccaagataccagcttctctgctgc
aaatatggtgcacctgaagatgaggagctcaaaacacagcagccattcatgctaaaaaat
cagctactaacactgaagataaaatgctcaaatcaacctgaacaacaaatattagaaaag
cagttgccagactccatgacaattcaaaaggtaaagggactgctgtcacgtcttctcaag
gttcctgtgtcagaacttctgttgtcctacgaaagttccaagatgccgggcagagaaatc
gaactagaaaatgacctgcagccattacagttttattctgtggagaatggagactgccta
ctggtgcgctggtag

DBGET integrated database retrieval system