KEGG   Rattus norvegicus (rat): 361258
Entry
361258            CDS       T01003                                 

Gene name
Cul2
Definition
(RefSeq) cullin-2
  KO
K03870  cullin 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04066  HIF-1 signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    361258 (Cul2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    361258 (Cul2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    361258 (Cul2)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    361258 (Cul2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361258 (Cul2)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECV complex
    Cullin
     361258 (Cul2)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Rio2_N TFIIE_alpha
Other DBs
NCBI-GeneID: 361258
NCBI-ProteinID: NP_001101887
RGD: 1310644
Ensembl: ENSRNOG00000015292
UniProt: D4A0H4
Position
17
AA seq 725 aa
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAE
TKIFLENHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSECHSIIRHERKNDMANMYVL
LRAVSSGLPHMIEELQRHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLA
KRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTV
IDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLC
TGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDV
KMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYL
QAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADE
YSYVA
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgtctttaaaaccaagagtagtggattttgatgagacgtggaacaagctgctaactaca
atcaaggctgtcgttatgttggaatatgtagagagagcaacatggaacgaccgcttctca
gacatctatgctttatgtgtggcctatcctgaaccacttggagaaagactttatgcggaa
acaaagatttttttggaaaatcacgttcggcatttatataagagagttctggagtctgaa
gaacaagtgcttgttatgtatcataggtactgggaagaatacagcaagggtgctgactat
atggactgcttatataggtatctcaatacccagtatattaaaaagaataaattgacggaa
gctgatttacagtatggctatggtggagtagatatgaatgaaccacttatggaaatagga
gagctagcattggatatgtggaggaagttaatggttgaaccccttcagaacatcctcatc
cggatgctgcttcgagaaattaaaaatgatcgtggtggagaagacccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaattcccctta
aagttttatcagggaatatttgtgtctccctttctgaccgaaacgggagaatattacaag
caagaagcttcaaatttattacaagaatcaaattgttcacagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattagatgtcgaaaatatttgcatccaagttcatatacg
aaagtgattcacgagtgtcagcagcggatggtggcagaccacttgcagttcttacactca
gagtgccacagcattattcggcacgagaggaagaacgacatggcaaatatgtacgtctta
cttcgtgctgtgtccagtggtttacctcatatgattgaggagctacagagacacatccac
gatgagggccttcgagcgaccagtaaccttactcaggaacatatgccaacactatttgtg
gaatcagttttggaagtgcacggtaaattcgttcaacttatcaacactgttttgaatggt
gatcagcattttatgagtgctttagataagcttgctaagtactgtgacaacttgctaaag
aagtcagcaaaggggatgacggagaatgaagtagaggacaagcttaccagcttcatcaca
gttttcaagtacatcgatgacaaggacgtctttcagaagttctatgcaagaatgctagca
aaacgtctaattcacgggctgtctatgtctatggattctgaagaagccatgatcaataaa
ttaaagcaagcctgtgggtatgagtttaccagcaagctgcatcggatgtacacagacatg
agtgtcagcgccgacctcaacaacaagttcaacaatttcatcagaaaccaagacactgtg
atcgatttggggattagtttccaaatatatgtccttcaggctggtgcgtggcctctcacc
caggctccgtcgtccacatttgcgatcccccaagagttagagaaaagtgtacagatgttt
gaattgttttatagccagcatttcagtggaaggaaactgacatggttacattatctctgt
acaggtgaagttaaaatgaactatttggggaaaccatatgtagctatggttacaacctac
caaatggcagttcttcttgcctttaacaacagtgaaactgtcagctacaaagagcttcaa
gacagcacccagatgaatgaaaaggagctaactaaaacaatcaaatcattacttgatgtg
aaaatgattaaccatgattcagaaaaggaagatatcgatgcagaatcttcattttcacta
aatatgagcttcagcagtaagagaacaaaatttaagattactacatcaatgcagaaggat
acaccacaagaactggaacagactagaagtgctgtagatgaggaccggaaaatgtatctt
caagctgctattgtccgcatcatgaaagcacggaaagtgcttcggcacaacgccctcatt
caggaggtaatcagccagtcaagagccaggttcaatcccagtatcagcatgattaagaag
tgcatagaagttctgatagacaagcagtacatcgagcgcagccaagcatctgcagatgaa
tacagttacgttgcgtga

DBGET integrated database retrieval system