KEGG   Rattus norvegicus (rat): 361271
Entry
361271            CDS       T01003                                 

Gene name
Upf2
Definition
(RefSeq) regulator of nonsense transcripts 2
  KO
K14327  regulator of nonsense transcripts 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    361271 (Upf2)
   03015 mRNA surveillance pathway
    361271 (Upf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361271 (Upf2)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     361271 (Upf2)
   mRNA cycle factors
    P-body specific factors
     361271 (Upf2)
SSDB
Motif
Pfam: MIF4G Upf2
Other DBs
NCBI-GeneID: 361271
NCBI-ProteinID: NP_001101891
RGD: 1309178
Position
17
AA seq 1268 aa
MPAERKKSASMEEKESLLNNKEKDCSERRPVSSKEKSKDDLKITAKKEVSKVPEDKKKKL
EEDKRKKEDKERKKKEEEKVKAEEELKKKEEEEKKKQEEEERKKQEEQAKRQQEEAAAQL
KEKEESLQLHQEAWERHQLRKELRSKNQNAPDNRPEENFFSRLDSSLKKNTAFVKKLKTI
TEQQRDSLSHDFNGLNLSKYIGEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSLL
QVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKSIINADRES
HTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLNFPPSEIISPEKQQPFQNLLKEYFT
SLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLD
ENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAI
LFKDNEKSQNKDSSKDDSKEAKEPKDNKEASSPDDLELELENLEINDDTLELEGGDEAED
LTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKANRK
KLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINIET
KNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHL
RTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVRRKRPPLQEYVRKLLYKD
LSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVG
IHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVN
PDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVW
TKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKESKDS
MTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDDEDEGEEEEEENTDYLTDSN
KENETDEENAEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQRSGESVKVHQLDVAIPL
HLKSQLRKGPPLGGGEGETESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWNQQQA
EQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPNADLI
FKTGGRRR
NT seq 3807 nt   +upstreamnt  +downstreamnt
atgccagctgagcggaaaaagtcagcaagtatggaggaaaaagaatctttactaaacaac
aaggaaaaagactgcagtgagaggcggccagtgagcagcaaggagaaatcaaaagacgat
ctcaagatcactgccaagaaggaggtcagtaaggtcccagaagacaaaaagaagaaactg
gaagaagataagagaaaaaaggaagacaaggaacgtaagaaaaaagaggaagagaaggtg
aaggcagaggaagagttgaagaagaaggaagaggaagaaaagaaaaaacaggaagaggaa
gagaggaaaaagcaggaggagcaggccaagcggcagcaggaagaagcagctgcccagctg
aaagagaaagaagaatctcttcagcttcatcaggaggcgtgggaacgccatcaactacga
aaggaactccgtagcaaaaaccaaaatgctccagacaaccgaccagaggaaaatttcttt
agccgcctagattcgagcttaaagaaaaatactgcttttgtcaagaaactaaaaacaatt
acagaacaacagagagactccttgtctcatgattttaatggcctgaatttaagcaaatat
attggggaagccgtagcttccattgtggaagcaaaattaaaaatctctgacgtgaactgt
gccgtgcacctctgctctctctttcaccagcggtacgctgactttgcaccctcacttctt
caggtgtggaaaaaacattttgaagcaaggaaagaggagaaaacgcccaacattaccaag
ctaagaactgacttgcgtttcattgcagaattgacaatagtgggaatcttcactgacaag
gaaggtctttccttaatctatgaacagctaaaaagtattattaatgctgatcgagaatcc
cacactcatgtgtctgtggtgattagtttctgtcgtcattgtggagatgatattgctgga
cttgtaccgaggaaagtaaagagtgctgcagagaagtttaatttgaactttcctcctagt
gagataattagcccagagaagcagcagcctttccagaatcttttaaaagagtactttacg
tctctgaccaaacacctgaaaagggaccacagggagcttcagaatactgagaggcaaaac
aggcgtattctgcactctaaaggcgagctaagtgaagacaggcataaacagtatgaagag
ttcgccatgtcttaccagaagctgctggcaaattctcaatccttagccgaccttttggat
gaaaatatgccagatcttcctcaggacaaaccgacaccagaagagcatggacctggaatc
gatatatttacacctggaaaacctggagaatatgacttagaaggtggcatatgggaagac
gaagacgctcggaatttttatgaaaacctcatcgatttgaaagcatttgttccagccatc
ttgtttaaagacaatgaaaaaagtcagaacaaagattctagcaaagatgattccaaagag
gcaaaagaaccaaaggataataaggaagcatcaagtcccgatgatttggaacttgagttg
gagaatttagaaattaatgatgacacactggagttagaaggtggagatgaagctgaagat
cttacaaagaaactccttgatgaacaagaacaagaagatgaagaagccagcactggatct
cacctcaaactcatagtggatgctttcctccagcagctgcccaactgtgtcaaccgagac
ctgattgacaaggcagccatggacttttgcatgaacatgaacacaaaggcaaacaggaag
aagttggttcgggcgctcttcatagttcctaggcaaaggttggatttgctcccattttat
gcaagattggttgctacattgcatccctgcatgtctgatgtagcagaggatctttgttcc
atgctgaggggggatttcagatttcatgttcgaaaaaaggaccagatcaacattgaaaca
aagaataaaactgtccgttttattggagaactaaccaagtttaagatgttcaccaaaaat
gatacactgcattgtctaaagatgcttctgtcagacttttctcatcatcatattgaaatg
gcatgtaccctactggagacctgtggacggtttcttttccgatctccagaatcacacctg
aggaccagtgtgcttttggagcaaatgatgagaaagaagcaagcaatgcacctggacgcg
cgctacgttacaatggtggagaacgcgtattactactgcaacccaccaccagccgagaag
acagtgagaaggaagcggcctcctcttcaggagtatgtccgcaaacttctgtacaaggat
ctctctaaggtcaccacggaaaaggttttgagacagatgcgaaagttgccctggcaggac
caagaagttaaagactatgtcatttgttgtatgataaacatttggaatgtgaaatacaat
agtattcactgtgtagccaacctcctagcaggactagtgctttaccaggaggatgttggg
atccacgttgtggacggagtacttgaagatattcgattgggaatggaggttaatcaacct
aaatttaaccagaggcgcatcagtagtgccaagttcttaggagaactttataattacaga
atggtcgaatcggctgttattttcagaactctttattcttttacttcatttggtgtcaac
cctgacgggtctccaagttccctggaccctcctgagcatctgtttagaattagactagtc
tgcactattttggatacctgtggccagtactttgacagaggttccagtaaaagaaaactt
gactgcttccttgtatattttcagcgttatgtttggtggaagaaaagtttggaggtttgg
acaaaagaccatccatttcctattgatatagattacatgatcagtgatacactagaactg
ctaagaccaaagatcaaactctgtaattctctggaagaatccatcaggcaggtacaagac
ttggaacgagaattcttaataaaactaggcctagtaaatgacaaagagtccaaagattct
atgacagaaggggaaaatcttgaagaggatgaagaagaagaagaaggaggagctgagaca
gaggaacagtctggaaatgagagtgaagtaaacgagccagaagaagaagagggttctgat
gatgaagacgagggagaggaggaggaagaagagaatacagattacctcacagattccaac
aaggagaacgagactgatgaagagaatgctgaggtgatgattaagggaggcggactgaag
catgttccttgtgtagaagatgaggacttcattcaagctctggacaaaatgatgctagaa
aaccttcagcgaagtggtgaatctgtgaaagtacaccaacttgatgttgctattcctttg
catctcaaaagccagctgaggaaagggcccccacttggtggtggggaaggagagacagag
tctgcagacacgatgccgtttgtcatgctgacaaggaaaggcaataaacagcagtttaag
attctcaatgtgcccatgtcatcccaacttgctgcaaatcactggaaccagcaacaagca
gaacaagaggagaggatgaggatgaaaaagctcaccttagacatcaacgaacgacaagaa
caagaagattatcaagaaatgttgcagtctctcgcacagcgcccagctccagcgaacact
aatcgtgagcggcggcctcgttaccaacatccaaagggagcgcctaatgcagatctaatc
tttaagactggtgggaggagacgttga

DBGET integrated database retrieval system