KEGG   Rattus norvegicus (rat): 361273
Entry
361273            CDS       T01003                                 

Gene name
Sec61a2
Definition
(RefSeq) protein transport protein Sec61 subunit alpha
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03060  Protein export
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    361273 (Sec61a2)
   04141 Protein processing in endoplasmic reticulum
    361273 (Sec61a2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    361273 (Sec61a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rno02044]
    361273 (Sec61a2)
Secretion system [BR:rno02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   361273 (Sec61a2)
SSDB
Motif
Pfam: SecY Plug_translocon
Other DBs
NCBI-GeneID: 361273
NCBI-ProteinID: NP_001163814
RGD: 1305948
Ensembl: ENSRNOG00000023278
Vega: OTTRNOG00000001991
UniProt: D3ZEH3
Position
17
AA seq 476 aa
MGIKFLEVIKPFCAVLPEIQKPERKIQFREKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQAIVYVMTGMYGDPAEMGAGICLLIIIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTINTGRGTEFEGAVIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATVFVFAVVIYFQGFRVDLPIKSARYRGQYSSYPIKLFYTSNIPIILQSALVSN
LYVISQMLSVRFSGNFLVNLLGQWADVSGGGPARSYPVGGLCYYLSPPESMGAIFEDPVH
VVVYIIFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRDTSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQAEVGGMGALFF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgggcatcaagtttttagaagttattaaacctttctgtgcagttctaccagaaattcag
aagcctgaaaggaaaattcagtttagagagaaggtactgtggactgctataacactcttc
attttcttagtatgctgtcagattccactgtttgggatcatgtcgtcggactctgcggat
cccttctactggatgagagttattcttgcatccaacagaggaacattgatggaattgggt
atttccccaattgtaacatctggtttgattatgcagttgttagctggagccaaaatcatt
gaagtcggagatacacccaaagatagagctctgttcaatggagcccagaaactatttggt
atgatcattaccattgggcaagccattgtgtatgtcatgacggggatgtacggggaccct
gcagaaatgggtgctgggatctgcctccttatcattattcagttgtttgttgctggtttg
attgtgctgctgttagatgagctgctacagaagggttacggcttggggtctggtatttcc
ctctttattgccaccaacatctgtgaaaccattgtctggaaggcctttagtcccactacc
attaacactggcagaggtacggagtttgaaggtgcagtcatagctctgtttcatttgttg
gctacccggacagacaaggtccgagccctgagggaggccttctatcggcagaacctcccc
aacctcatgaacctcatcgccaccgtcttcgtgtttgcggtcgtcatctattttcagggg
tttcgtgttgacttgcccattaagtcggcccggtatcgcggacagtacagtagctatccc
atcaagctcttctacacatcgaatattcccataatcctccagtccgccctagtttcaaac
ttgtacgtcatttcccagatgctgtctgttcgatttagtggcaacttcttagtaaactta
ctaggacagtgggccgatgtcagcgggggaggacctgctcgctcctaccctgttggtggc
ctgtgttactatctctctcctcctgagtccatgggagccatatttgaggatcctgttcat
gtagtcgtgtatattatcttcatgttggggtcgtgtgcattcttttctaagacgtggata
gaagtttctggttcctcagccaaagatgtggccaagcagcttaaagagcagcagatggtg
atgaggggccacagagacacctccatggttcatgagctgaacaggtacatccccacagca
gctgcctttgggggtctatgcatcggtgccctgtcggtactagcagacttcctgggcgcc
attggctcgggcactggaattctgcttgcagtcactattatttatcagtattttgaaata
tttgttaaggaacaggctgaagttggtggaatgggtgctttgtttttctaa

DBGET integrated database retrieval system