KEGG   Rattus norvegicus (rat): 361274
Entry
361274            CDS       T01003                                 

Gene name
Nudt5
Definition
(RefSeq) nudix hydrolase 5
  KO
K13987  ADP-sugar pyrophosphatase / 8-oxo-dGDP phosphatase / ADP-D-ribose pyrophosphorylase [EC:3.6.1.13 3.6.1.58 2.7.7.96]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    361274 (Nudt5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.96  ADP-D-ribose pyrophosphorylase
     361274 (Nudt5)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     361274 (Nudt5)
    3.6.1.58  8-oxo-dGDP phosphatase
     361274 (Nudt5)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 361274
NCBI-ProteinID: NP_001007734
RGD: 1359284
Ensembl: ENSRNOG00000017741
UniProt: Q6AY63
Position
17q12.3
AA seq 219 aa
METQEPKDSSPPTEQRILSEELISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSAD
AVSVIPVLQRTLHHECIVLVKQFRPPMGGYCLEFPAGLIEDGESPEAAALRELEEETGYK
GDIAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPGDGEFVEVISLPKNDLLT
RLDALGAEDRLTVDARVYAYALALKHANAKPFEVPFLKF
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagacccaagaaccaaaagactcttctccccccaccgagcagcgcattctttcagag
gagttgatctcagaaggaaaatgggtcaaatttgaaaaaacaacttacatggaccccacc
ggtaaaactagaacctgggaaacagtgaagcttacgaccaggaagggaaaatctgctgat
gccgtgtcagtcataccagtcctgcaaagaacgcttcatcatgagtgcattgtcctggtg
aagcagttccggcccccgatgggcggctactgcctggagttcccagcagggctcatcgaa
gacggggaaagcccagaagcggctgctctgcgggagctggaggaagagactggctacaaa
ggtgacattgctgaatgctctccagctgtgtgtatggatccaggcttgtcaaactgcacc
acacacgttgtgacagtgaccatcaatggagatgacgcaggaaatgtaaggccgaaaccc
aaaccaggggacggagagtttgtggaagtgatttctttaccaaagaatgatctgctgacg
agacttgacgctctgggtgcagaagaccgtcttacagtggacgccagggtctacgcctat
gctctggcgctgaaacatgccaacgccaagcccttcgaagtgcccttcctcaaattttaa

DBGET integrated database retrieval system