KEGG   Rattus norvegicus (rat): 361282Help
Entry
361282            CDS       T01003                                 

Gene name
Plxdc2
Definition
(RefSeq) plexin domain containing 2
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PSI AJAP1_PANP_C Podoplanin DUF5305
Motif
Other DBs
NCBI-GeneID: 361282
NCBI-ProteinID: NP_001101892
RGD: 1305962
Ensembl: ENSRNOG00000000142
UniProt: B5DEZ8
Position
17q12.3
AA seq 530 aa AA seqDB search
MARFPRAHLAAAGVMLLCHFLTDRFQFAHGEPGHHMNDWKYVVANTSPQSEEGVEVDSQA
YSHRWKRNVDPFKAVDTNRASMGQDSPESRGFPDLLLDDGQDNTTQIEEDTDHNYYISRI
YGPADSASRDLWVNIDQMEKDKVKIHGILSNTHRQAARVNLSFDFPFYGHFLNEVTVATG
GFIYTGEVVHRMLTATQYIAPLMANFDPSVSRNSTVRYFDNGTALVVQWDHVHLQDNYNL
GSFTFQATLLMDGRIIFGYKEIPVLVTQISSTNHPVKVGLSDAFVVVHRIQQIPNVRRRT
IYEYHRVELQMSKITNISAVEMTPLPTCLQFNGCGPCVSSQIGFNCSWCSKLQRCSSGFD
RHRQDWVDSGCPEEVQSKEKMCENTEPGETSQTTTTAQTTTTQFRVLTTTRRAVTSHMPT
SLPTEDDTKIALHLKDSGASTDDSAAEKKGGTLHAGLIVGILILVLIIAAAILVTVYMYH
HPTSAASIFFIERRPSRWPAMKFRRGSGHPAYAEVEPVGEKEGFIVSEQC
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggttcccgagggcccacctggcggcagcaggagttatgttactttgtcacttt
ttaacagaccggttccagttcgcccacggggagcctggacaccatatgaatgactggaag
tatgtagttgcaaacacctcgcctcagagtgaagagggggtggaagtggactctcaagca
tacagccaccggtggaaaagaaacgtggacccttttaaagctgtagacacaaaccgagcc
agcatgggccaagactctccggagtccagaggcttccccgacctgctactggatgacggg
caggacaacaccacccagatcgaggaggacacagatcacaattactacatttctcggata
tatggcccagcggattctgccagccgggatctgtgggtgaacatagaccaaatggaaaag
gacaaagtgaagattcacgggatactttccaacactcatcggcaagctgcaagagtgaat
ctgtccttcgattttccattttatggtcattttctaaatgaagtcactgtggcaactggg
ggtttcatatacactggagaagttgtgcatcgaatgctgacagctacacagtacatagcc
cctttaatggcaaattttgatcccagtgtatccagaaattcaaccgtcagatactttgat
aatggcacagctcttgttgtccagtgggaccatgtccacctgcaggataattacaacttg
ggaagcttcacattccaggccacactcctcatggatgggcgtatcatcttcggatacaaa
gaaattccggtcttggttacacagataagctccaccaaccatccagtcaaagtcgggttg
tctgatgcatttgtcgtagtccacaggatccagcaaatacccaatgttcgaagaagaaca
atttatgaatatcaccgtgtagaactacagatgtccaaaattaccaacatttcagctgtg
gagatgaccccactcccaacatgtctccaattcaatggttgtggcccttgtgtgtcctcg
cagattggtttcaactgcagttggtgtagcaaacttcaaagatgctcgagtggattcgat
cgccatcggcaggactgggtggacagtggatgccctgaagaggtacagtcaaaggagaag
atgtgcgagaacacagagccaggggagacatctcaaactactacgaccgcacaaacaacc
accacgcaattcagggtcctgaccaccaccaggagagctgtgacgtcgcacatgcctacc
agcctgcctacagaagatgatacgaagatagcactgcatctcaaagacagcggagcctcc
acagatgacagtgccgccgaaaagaaaggaggaaccctccatgcaggcctcatcgttgga
atcctcatcttggtcctcattatcgcagcagccattctggtgacagtttacatgtatcac
cacccaacatcagcagccagcatcttcttcattgagagacgcccaagcagatggccagca
atgaagtttcgaagaggatcgggacatcctgcctatgcggaagttgaaccagttggagag
aaagaaggttttattgtatcagagcagtgctaa

DBGET integrated database retrieval system