KEGG   Rattus norvegicus (rat): 361293
Entry
361293            CDS       T01003                                 

Symbol
Riok3
Name
(RefSeq) serine/threonine-protein kinase RIO3
  KO
K08872  RIO kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    361293 (Riok3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     361293 (Riok3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  RIO family [OT]
   361293 (Riok3)
SSDB
Motif
Pfam: RIO1 Pkinase APH Kdo ABC1
Other DBs
NCBI-GeneID: 361293
NCBI-ProteinID: NP_001101893
RGD: 1310833
Ensembl: ENSRNOG00000023376
UniProt: D3ZND9
Position
18
AA seq 519 aa
MDLVGVSSPEPGPAAAWGPSKCPWATPQNTVSCSLAEVMSEELAKELQLEEEAAAFPEAV
VAEGPFISGENMDTSSDLMLAQMLQMEFDREYDAQLRREEKKFNGDSKVSISFENYRKVH
PFEDSDSSEDEVDWQDTRDDPYRPAKPVPTPKKGFIGKGKDITTKHDEVVCGRKNTARME
NFAPGFQVGDGIGMDLKLSNHVFNALKQHAYSEERRSARLHEKKEHSTAEKAVDPKTRLL
MYKMVNSGMLETITGCISTGKESVVFHAYGGSLEDEKEDGKVIPTECAIKVFKTTLNEFK
NRDKYIKDDFRFKDRFSKLNPRKIIRMWAEKEMHNLTRMQKAGIPCPTVVLLKKHILVMS
FIGHDQVPAPKLKEVKLSEEEMKDAYHQTLHLMQQLYKECTLVHADLSEYNMLWHAGKVW
LIDVSQSVEPTHPHGLEFLFRDCRNVSQFFQKGGVKEALNERELFNAVSGLSISADNEAD
FLAEIEALEKMNEDHVQKNGRKAASFLKDEGSPPMLYAE
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggatctggtcggagtgtcttcacctgaacccgggcccgcagcagcttggggacccagt
aagtgcccatgggctacccctcaaaacacagtatcctgttcactggcggaggtgatgagt
gaagaactggccaaagagctgcagttggaagaagaagcagctgctttccctgaagctgtc
gttgctgaaggaccgtttatttctggagaaaacatggacacttccagtgacctgatgctg
gctcagatgctacagatggaatttgacagagaatacgatgcacagcttaggcgtgaagaa
aagaagttcaacggtgacagcaaagtttccatttcatttgaaaactatcggaaagttcat
ccctttgaagacagtgacagctctgaggacgaggttgactggcaggacactcgcgacgat
ccctacagaccagcaaagccagttcctactcccaaaaagggttttattggaaaaggaaaa
gacatcacaactaagcatgatgaagtagtatgtggaagaaagaacacagcaagaatggaa
aactttgcacctggctttcaggttggagatggaattggaatggatttaaaactatccaac
cacgtttttaatgctttaaaacaacatgcctactcggaagaacgtcgaagtgcccgtctc
catgagaagaaggaacattccaccgctgaaaaagcagttgatcctaagacacgcttactt
atgtataaaatggtcaactctggaatgttggagacaatcactggctgtattagtacagga
aaggaatctgttgtctttcatgcatatggagggagcctggaggatgaaaaggaggatggt
aaagttataccaacagaatgtgccatcaaggtatttaaaacaactcttaatgagttcaag
aatcgtgacaaatacattaaagatgatttcaggtttaaagatcgcttcagtaaactaaat
ccacgtaagatcatccgcatgtgggcagagaaggagatgcacaatctcacaagaatgcag
aaggctggaattccttgtccaacagttgtactgcttaagaagcacattttagttatgtct
ttcattggccacgatcaagttccagcccctaaattaaaggaagtaaagcttagtgaagaa
gaaatgaaagatgcctaccaccagactctccacttgatgcagcagttgtacaaggaatgc
acccttgtgcacgccgacctcagcgagtacaacatgctgtggcatgctgggaaggtctgg
ttgattgatgtcagtcagtcggtagaaccgacccatcctcatggcctggagttcttattc
cgtgactgtaggaacgtttcacagttcttccagaagggaggagtaaaggaagcccttaac
gagcgggagctgttcaatgctgtttctggcctgagcatctcagcagacaatgaagctgac
ttcttagctgagatagaagctttggagaaaatgaacgaagatcatgttcagaagaatgga
aggaaagcagcctcgtttctgaaagatgaaggaagtccacccatgctgtatgcagagtag

DBGET integrated database retrieval system