KEGG   Rattus norvegicus (rat): 361303Help
Entry
361303            CDS       T01003                                 

Gene name
Lims2
Definition
(RefSeq) LIM zinc finger domain containing 2
  KO
K23354  LIM and senescent cell antigen-like-containing domain protein 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    361303 (Lims2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM DUF2321 zf-RRN7 Med27 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 361303
NCBI-ProteinID: NP_001012163
RGD: 1305273
Ensembl: ENSRNOG00000016021
UniProt: Q5PQM7
Position
18p12
AA seq 306 aa AA seqDB search
MSECLADAMCQRCQARFAPTERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCE
HDFQMLFAPCCGFCGEFVIGRVIKAMNANWHPGCFRCELCDVELADLGFVKNAGRHLCRP
CHNREKAKGLGKFICQRCHLAIDEQPLMFKNDPYHPDHFSCSHCGKELTSDARELKGELY
CLPCHDKMGIPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYC
ETHYNQLFGDVCYNCSHVIEGDGEASVPKPLPPLLSPNQSVLLVVGGAGGVGGGLGDVGE
WRNCGW
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatgtctggcggatgccatgtgccagcggtgccaagcccggtttgcccccaca
gagcgcatcgtcaacagtaatggggagctctaccatgagcactgctttgtgtgtgcacag
tgcttccggccgtttcccgaggggctcttctatgagtttgagggccggaagtactgtgaa
cacgacttccaaatgctgttcgctccatgctgcggattctgtggtgagtttgtcatcggc
cgcgtgatcaaggccatgaacgccaactggcatccgggctgcttccgctgtgagctgtgc
gacgtggagctggctgacctgggctttgtgaagaacgcaggcaggcacctctgccggcct
tgccacaaccgtgagaaggccaagggcctgggcaaattcatctgccagaggtgtcacctc
gccattgatgagcagcccctcatgttcaagaatgatccctaccacccggaccacttcagc
tgctcccactgtgggaaggagctgacctctgatgcccgagagctgaagggtgagctctac
tgcctgccttgccacgacaagatgggcattcccatctgtggggcttgccgccggcccatt
gagggccgtgtggtcaatgcgctgggcaaacagtggcacgtggagcacttcgtctgcgcc
aagtgtgagaagccattcttggggcaccggcactatgagaagaaaggcctagcatactgt
gagacccactacaaccagctctttggggatgtctgctacaactgcagtcatgtgattgag
ggtgacggtgaggcctctgtccccaagccccttcctcccttgctttctcccaaccagtct
gttctcctggtggtgggaggggcaggtggggtgggagggggtttgggggatgtgggggag
tggaggaattgtggttggtag

DBGET integrated database retrieval system