KEGG   Rattus norvegicus (rat): 361314
Entry
361314            CDS       T01003                                 

Gene name
Arap3
Definition
(RefSeq) arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X4
  KO
K12490  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    361314 (Arap3)
   04024 cAMP signaling pathway
    361314 (Arap3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    361314 (Arap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361314 (Arap3)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    361314 (Arap3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    361314 (Arap3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    361314 (Arap3)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   361314 (Arap3)
SSDB
Motif
Pfam: RhoGAP PH ArfGap RA PH_8 PH_6 PH_3 PH_2
Other DBs
NCBI-GeneID: 361314
NCBI-ProteinID: XP_008770295
RGD: 1304938
Ensembl: ENSRNOG00000055527
Position
18
AA seq 1459 aa
MEPTPSPAPDAQPSKPVPKPRTVFGLSNPANAQKPGLNPIFWNPEVSRNSECTQRSPPVL
PSSSEQPSALNTMEMMPNAIYFGLDLRGRAQAAQDLTPDSSQATVPTPAFRPTTGTVHIM
DPGCLYYGVQPVGVPGVPDRRDGRGVCQERAEHRQDQETREDAGYASLELPGDSILSLPT
QDAETSDDLISPYASFSSTADRPVPLLSGWLDKLSPQGNYVFQRRFVQFNGRSLMYFGSD
KDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFRTESEAQRDIWCSTLQSCLKEQRL
LGHPRPPHPPRPLRTGMLELRGHKAKVFAALIPGELALYKSEQAFSLGIGICFIELQGCS
VRETKSRSFDLLTPHRCFSFTAESGGARQSWAVALQEAVTETLSDYEVAEKVWSNPANRH
CADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWTNEIVQLFIVLG
NDRANCFWAGALPPGEGLHPDAAPGPRGEFISRKYKLGLYRKPHPRHPDHSQLLQALCAA
MVGPNLLKNMTQLLCVEASEGEEPLSPSALNGSLLSLLPSDSSPGVYNEVVVPATYRGFL
YCGPISNKAGAPPLRRGRDAPPRLWCVLGAALEMFASESSSEPLSLLQPQDVVCLGISPP
PADSGDLDRFPFSFELILTGGRIQHFATDGADSLEAWISAVGKWFSPLSCHQLLGPGLLR
MGRLWLRSPSHAGLAPGLWLSGFGLLRGDHLFLCPAPGPGPPAPEDMVHLRRLQEISVVS
AADTPDKKEHLVLVETGRTLYLQGEGRLDFAAWNTAIGGAAGGGGTGLQEQQMSRGDIPI
IVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRPREHFVEDVTDTLK
RFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEVISCLPRVNRRTLATLIGHLYRV
QKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQELIDGYISVFDIDSDQAAQIDLE
VSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELTNQVLEMRGAASGT
DLWVTFEILDHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKVSMAHAGCLFTGVR
RESPRVGLLRCREEPPRLLGSRFQERFFLVRGRCLLLLKEKKSSKPEREWSLEGAKVYLG
IRKKLKPPTLWGFTLILEKMHLCLSCTDEEEMWDWTTSILKAQHDDQQSVVLRRHSSSDL
ARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLSMFFPMKSSQGSVEEQDELEEP
VYEEPVYEEVGAFPELTKDMTSTWEWSTKSDTPLTSQRSFDQTPLTKASMLVQEERIPEP
PPGPPSKSSPQARGSLEEQLLQELNNLILRKGEPATCPESPSQPTSPQSPSPTSLPTQTP
SLPTQIPCASNPPSSQPLT
NT seq 4380 nt   +upstreamnt  +downstreamnt
atggagccaactcccagcccagcccctgatgcccaaccctccaagcctgtgcctaagccc
agaacggtgtttgggctcagcaaccctgccaatgcccagaagcctggactgaacccaatc
ttctggaatccagaagtatccaggaactcagagtgtacacagaggtcccctcctgtcctt
ccgtcttcctctgaacagccttcagccctgaataccatggagatgatgcccaatgccatc
tactttggcctggacttaagaggtcgggcccaggcagctcaggacctgactccagacagt
tcccaggcaactgtcccaacccctgccttcaggcctacgacaggcacagtgcacattatg
gatcctggttgcctgtactatggtgtccagcctgtgggggtcccaggagtccctgacaga
agagatggcagaggtgtctgtcaggaaagggctgaacacagacaggatcaggagacacgg
gaggatgctggttatgccagcctcgagctacctggggactccattctttcgctacccacc
caggatgcagagaccagtgatgacctcatttcgccctacgccagtttctcctccacagca
gatcgtccagtgcctctgctcagcggctggctggacaagctctcgcctcagggaaactat
gtgttccagagacgtttcgtgcagttcaacggaaggagtctgatgtactttggcagtgac
aaggaccccttccccaaaggtgtgatccctctgactgccatcgagatgacccgaagcagc
aaggacaacaaattccaggtcattaccggccagagagtatttgtgttccgcacagagagt
gaggctcagcgtgacatatggtgctctacactgcaatcctgcctgaaggagcagcgcctc
ctgggccacccccgaccccctcacccaccacgacccctccgcacgggcatgttagagttg
cgtggacacaaggccaaggtgtttgctgccttgatccctggagagctggcactgtacaag
agtgagcaggccttctcactgggcattgggatctgcttcattgaactgcaaggctgcagt
gtccgggagaccaagagtcgaagctttgatctgctcacaccccatcgctgcttcagcttc
acagccgagtctgggggggctcgacagagctgggcagtcgctctacaagaagcagtaacc
gagaccctgtctgactacgaggtggctgagaaggtctggtcaaacccggcaaaccggcat
tgcgcagactgcagggcctcccggccagattgggctgctgtcaacctgggggtagtcatc
tgcaagcagtgtgcaggtcagcaccgggccctgggctctgggatctccaaggtgcagagc
ctgaagctggacactagcgtctggactaatgagatagtgcagttgttcattgtcctggga
aatgatcgtgccaattgcttctgggcaggggcactccccccaggtgaagggctacatcca
gatgcagcccctggccctcgaggagagttcatctcccgaaagtataagttgggtctctac
cggaagccccaccctcggcatccagatcacagccagcttctacaggcactgtgtgcagct
atggtgggacccaacctgctaaagaacatgacccagctcctctgtgttgaagcctctgag
ggagaggaacccttgtctccttcagccctcaatggcagcttgcttagccttctcccttca
gactcttcccctggagtatacaatgaggtggtggtgcctgccacttacagaggtttcctg
tactgtggtcccatcagcaacaaggctggagccccaccccttcgcaggggccgggacgct
cctccccgcctgtggtgtgtgctgggagctgctctggaaatgtttgcctcagagagcagc
tctgaacccctcagccttctccagccccaggatgttgtatgtttgggcataagtccccca
cctgctgattcaggtgaccttgacaggttccccttttcctttgaactcatcctcactggg
ggaagaattcagcattttgccactgatggagcagacagtctagaggcctggatcagcgca
gtaggcaagtggttttccccgctcagctgtcaccagctattgggccccgggctgctgcgg
atgggtcgcctgtggctacggtccccctcccacgcaggcctggcccctggtctctggctg
tcagggttcggcctccttcgtggtgatcatctcttcctgtgcccagcgcccggccctgga
ccccctgctcccgaggacatggtgcatttacggcgtctacaggagatcagcgtggtctct
gcagccgacactccagacaaaaaggagcatttggtccttgtagagacaggaaggaccctg
tatttgcagggggaaggcaggctagattttgcagcgtggaacacggccattggaggtgct
gctggagggggtggaacgggcctgcaggagcagcagatgagccggggagatatccctatt
atagtggatgcttgcattagttttgtcacgcagcacgggcttcggctggagggtgtatat
cggaaaggaggtgctcgggcccgcagcctgcgactcttggctgagtttaggcgggatgcc
cggtcagtgaagcttagaccacgggaacactttgtagaagatgttactgacacactcaaa
cgcttctttcgagagcttgatgaccccgtgacctctgctaggttgctgcctcgatggaga
gaagctgcagagcttccccagaagaatcagcgcctggagaagtacaaagaagtgattagc
tgcctgcctcgagtcaaccgccggacactggccaccctcattgggcatctgtatcgggtg
cagaagtgtgcggctctaaaccagatgtgcacgcgaaacctggccctactgtttgcacct
agtgtgttccagacagatgggaggggagaacatgaggtccgggtactgcaggagctcatc
gatggctacatctctgtcttcgatattgactccgaccaggcagctcagattgacttggag
gtcagtctcatcaccacctggaaggacgtgcagttgtcccaggcgggagacctcatcatg
gaggtttatatagaacagcagcttccagacaattgtgtcaccctaaaggtgtccccaaca
ctgactgctgaggagctgactaaccaggtgctggagatgcgaggggcagcatcagggaca
gacttgtgggtgacatttgaaattcttgatcatggagagcttgagaggccactacacccc
aaagaaaaggttctagagcaggccttgcaatggtgccagctcccagagccctgctcagcc
tctctgcttctgagaaaagtctctatggcacacgctggctgcctcttcacaggagtccgt
cgggagagcccacgggtggggctgctacggtgccgtgaggaaccacctcgcttgctggga
agccgtttccaggagaggttctttttggtgcgtggccgatgcctgctgctactcaaggag
aagaagagctcgaagccagaacgagagtggtctctggaaggtgccaaggtctacctggga
atccgtaagaagttaaagcctccaacactatggggtttcacgttgatattggaaaagatg
cacctctgtctgtcctgtactgatgaggaggagatgtgggactggaccacaagcatcctt
aaagcccagcatgatgaccagcagtcagtggttttacgtcgtcattcctcctctgacctt
gcccgtcagaagtttggcactatgcccttgctgcccatccgaggagatgacagtggagcc
accctactctctgccaatcagaccctgcggcgactgcacaaccggagaaccttatccatg
ttctttccaatgaaatcgtctcaggggtctgtggaggagcaagatgagctggaggagcct
gtgtatgaagagccagtatatgaggaggttggggccttccctgagcttaccaaggacatg
acctccacatgggagtggtcgaccaagtcagacacaccccttaccagccagaggtccttt
gatcaaacccccctcaccaaagcaagcatgttggtccaggaggagaggatacctgagcct
cctccaggacccccttcaaaaagcagtcctcaggcacgagggtccctagaggaacagctg
ctccaggagctcaacaacctcatcttgaggaaaggagaacctgccacgtgtccagaaagt
ccttcccagcccaccagtcctcaatcccccagccccaccagccttccaacacagacaccc
agcttacccacccaaatcccctgcgcttccaatccaccctccagccagcccctcacatga

DBGET integrated database retrieval system