KEGG   Rattus norvegicus (rat): 361323
Entry
361323            CDS       T01003                                 

Gene name
Commd10
Definition
(RefSeq) COMM domain containing 10
  KO
K22566  COMM domain containing 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361323 (Commd10)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    361323 (Commd10)
SSDB
Motif
Pfam: COMM_domain DUF72
Other DBs
NCBI-GeneID: 361323
NCBI-ProteinID: NP_001004276
RGD: 1303015
Ensembl: ENSRNOG00000003958
UniProt: Q68FS9
Position
18q11
AA seq 202 aa
MAASAALILPQSPSMKKAVPLINAIDTGRFPRLLSRILQKLHLKAESSFSEEEEEKLQAA
FSLEKQELHLVLETISFVLEQAVYHNVKPAVLQQQLETIHLTQDKAEAFANAWSTMGHET
VEKFRQRILGPLKLETVGWQLNLQMAHSAQAKLQSPQAVLQLGVSKEDSKNLEKVLVEFN
HKELFDFYNKLETIQAQLDSLT
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcggcgtccgcggcgctgatcctaccccagagccccagcatgaagaaagcagtgccg
ctgataaatgcaatagacacaggaagattcccacgacttctcagccggattcttcaaaag
ctccacctgaaggccgagagcagtttcagtgaagaagaggaagaaaaacttcaggctgcg
ttctctctagagaaacaagaacttcacctggttctggagacaatatcatttgttttggaa
caggcagtgtatcacaacgtgaagccagcggtcctgcagcagcaactggagaccattcat
cttacacaggacaaagcagaagcatttgccaatgcctggtcgactatgggtcacgaaaca
gttgagaagttcaggcagaggatcctgggccctctcaagctagagacagtgggatggcag
cttaacctgcaaatggctcactcagctcaagcaaagctgcagtctcctcaggccgtgctg
caactgggagtgagcaaggaagactccaagaacctggagaaggttctagtggaattcaat
cacaaggagttgttcgatttctacaacaagctggagaccatacaagcacagctggattcc
ctcacatga

DBGET integrated database retrieval system