KEGG   Rattus norvegicus (rat): 361352
Entry
361352            CDS       T01003                                 

Gene name
Pqlc1
Definition
(RefSeq) PQ loop repeat containing 1
  KO
K23679  solute carrier family 66, member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    361352 (Pqlc1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC66: Lysosomal lysine-arginine transporter
   361352 (Pqlc1)
SSDB
Motif
Pfam: PQ-loop ER_lumen_recept DUF2678
Other DBs
NCBI-GeneID: 361352
NCBI-ProteinID: NP_001013207
RGD: 1305223
Ensembl: ENSRNOG00000059215
UniProt: Q5M880
Position
18q12.3
AA seq 247 aa
MEAEGLGWLLVPLHQLVSWVAAGAMVFGGVVPYIPQYRDIRRTQNADGFSTHVCLVLLVA
NILRILFWFGRHFESPLLWQSIVMILTMLLMLKLCTEVRVANELNVKRRSFAATDSKDEE
LRVPPRRPYLGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNYRHRSTEGMSL
KMVLMWTSGDTFKTAYFLLNGAPLQFSVCGLLQVMVDLAILGQAYAFAHHPQKPAPHAVH
PASAKAL
NT seq 744 nt   +upstreamnt  +downstreamnt
atggaagcggaaggcttgggttggcttctggtcccgttgcaccagctggtttcctgggtg
gccgctggggccatggtcttcggaggggtggtgccgtacataccccagtacagggacatc
cggaggactcagaacgctgacggtttttccacccacgtgtgcctggtgctattggtggcc
aatatcttacggatactcttctggtttggcaggcacttcgagtcgccgctcctgtggcaa
agcatagtcatgatccttacgatgctactgatgctgaagctgtgcaccgaggtccgcgtg
gccaacgagctgaacgtcaagcgccgctccttcgcagcgacagacagtaaggatgaagaa
ctcagagtgccccccaggcggccctacctgggtgtggccggctacatcacctacctgtcc
atcgactcggctctgtttgtggagacgttgggcttcctggcagtgctgacggaagccatg
ctgggtgtgccgcagctgtatcggaactatcgtcaccgctccacggagggcatgagcctc
aagatggtgctcatgtggacaagtggggacaccttcaagacagcctacttcttgctcaac
ggcgcacctctgcagttctccgtctgtggtctactacaggtcatggtggacctggccatc
ctggggcaggcctatgcctttgctcaccacccccagaagccagcaccccatgcagtgcat
cctgccagtgccaaggcgctctga

DBGET integrated database retrieval system