KEGG   Rattus norvegicus (rat): 361368
Entry
361368            CDS       T01003                                 

Gene name
Large1, Large
Definition
(RefSeq) LARGE xylosyl- and glucuronyltransferase 1
  KO
K09668  glycosyltransferase-like protein LARGE [EC:2.4.2.- 2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00515  Mannose type O-glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    361368 (Large1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    361368 (Large1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     361368 (Large1)
   2.4.2  Pentosyltransferases
    2.4.2.-  
     361368 (Large1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   361368 (Large1)
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24 Thump_like DUF4928
Other DBs
NCBI-GeneID: 361368
NCBI-ProteinID: NP_001101909
RGD: 1308895
Ensembl: ENSRNOG00000013742
UniProt: D4A390
Position
19p12-p11
AA seq 385 aa
MLGICRGRRKFLAASLTLLCIPALTWIYLFAGSLEDGKPVSLSPLESQAHSPRYTASSQR
ERESLEVRVREVEEENRALRRQLSLAQGQSPAHRRGNHSKTYSMEEGTGDSENQRAGIVA
GNSSECGQQPAVEKCETIHVAIVCAGYNASRDVVTLVKSVLFHRRNPLHFHLIADSIAEQ
ILATLFQTWMVPAVRVDFYNADELKSEVSWIPNKHYSGIYGLMKLVLTKTLPANLERVIV
LDTDITFATDIAELWAVFHKFKGQQVLGLVENQSDWYLGNLWKNHRPWPALGRGYNTGVI
LLLLDKLRKMKWEQMWRLTAERELMGMLSTSLADQDIFNAVIKQNPFLVYQLPCFWNVQL
SDHTRSEQCYRDVSDLKTTDVGGHL
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgctgggaatctgccgagggagacggaaattcctggctgcctctctgactctactctgc
ataccagccctcacctggatttatttgtttgccgggagccttgaagatgggaaacccgtg
tctctctctcccctggagtcccaagcccacagtcccaggtacaccgcctccagccaacgc
gagcgggagagcctggaagtacgagtgcgagaggttgaggaggaaaaccgcgccctgcgc
aggcaactcagcctggctcagggtcagagccctgctcaccgccgtgggaaccactccaag
acgtactccatggaggagggaacaggggacagtgagaaccaacgagctggcattgtggca
ggcaacagctctgagtgtgggcagcagccggctgtggagaagtgtgagaccatccatgtg
gccatcgtctgtgccggatacaacgccagcagggacgttgtcaccctggtgaaatccgtc
ctctttcataggcggaaccctctgcacttccacctcattgctgattctattgcggagcag
atcctggctactctcttccagacctggatggtacctgcagtccgagtagacttctataac
gctgatgagctcaagtctgaagtgtcctggattcccaacaaacattactctgggatttat
ggcctgatgaagctggtactgaccaagaccctacctgccaacctggagagagtcattgtc
ctagacaccgacattacctttgcaacagacatcgcagagctctgggctgtgttccataag
ttcaaaggtcaacaggtcctgggattggtagagaaccagagtgactggtatcttggaaat
ctctggaaaaatcaccgtccatggccagcccttggaaggggctataacacaggagtcata
ctactgcttctggacaagcttcggaagatgaagtgggagcagatgtggaggctgacggca
gagagggaactcatgggaatgctgtctacctccttggctgaccaggacattttcaatgct
gtcatcaaacaaaacccctttctggtgtatcagcttccctgcttctggaatgtgcagctg
tcagaccacacccgctctgagcagtgctacagagatgtgtccgatttaaagactacagat
gttggaggccatctgtaa

DBGET integrated database retrieval system