KEGG   Rattus norvegicus (rat): 361388
Entry
361388            CDS       T01003                                 

Gene name
Gab1
Definition
(RefSeq) GRB2-associated-binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04072  Phospholipase D signaling pathway
rno04722  Neurotrophin signaling pathway
rno05100  Bacterial invasion of epithelial cells
rno05205  Proteoglycans in cancer
rno05211  Renal cell carcinoma
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    361388 (Gab1)
   04014 Ras signaling pathway
    361388 (Gab1)
   04072 Phospholipase D signaling pathway
    361388 (Gab1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    361388 (Gab1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    361388 (Gab1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    361388 (Gab1)
   05226 Gastric cancer
    361388 (Gab1)
   05211 Renal cell carcinoma
    361388 (Gab1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    361388 (Gab1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    361388 (Gab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    361388 (Gab1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   361388 (Gab1)
SSDB
Motif
Pfam: PH PH_11 PH_8 PH_3 PH_13
Other DBs
NCBI-GeneID: 361388
NCBI-ProteinID: NP_001101914
RGD: 1311085
Ensembl: ENSRNOG00000017879
Position
19
AA seq 694 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEDMNKWVRCICDICGFNPT
EEDPVRPLASSSQAPADSPFAINTAPASAHMEPSSVALPPSYQLISLPPHPDTLGLREDP
QDYLLLINCQSKKPEPTRAHFDSAKPTSSETDCNDNVPSHKPPASSQGKHGMNGFFQQQM
VYDCPPPRVTSVSGESGLYNLPRSYSHDVLPKESPSSTEADGELYVFNTPSGTSSVEAQM
RHVSISYDIPPTPGNTYQVPRTFPEGTLGQSSKLDTIPDVPPPRPPKPHSTHDRSPVETC
GVPRTASDTDSSYCIPPAGMPPSRSNTISTVDLNKLRKDAGSQDCYDIPRTFPSDRSSSL
EGFHNQLKIKNVLAAGNVSGEELDENYVPMNPNSPPRHHPSSFAEPIQEPNYVPMTPGTF
DFSAFGMQVPPPAHLGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLEIKPLS
EWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSNED
QNLFCNNSLEGASSPMTKPKGDKQVEYLDLDLESGKSTPPRKQKNSGSGSSMSDERVDYV
VVDQQKTLALKSTREAWTDGRQSTESETPTKNVK
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgagcggcggcgaagtggtttgctcgggatggctccgcaagtcccccccggagaagaag
ttgaagcgttatgcgtggaagagaaggtggtttgtgttgcgcagtggccgtttgaccgga
gaccccgatgtcctggagtattacaaaaacgatcatgccaagaagcctatccggattatt
gatttaaatttatgtcagcaagttgatgctgggttgacattcaacaaaaaggagtttgag
aacagctacatctttgatatcaacaccatcgatcggattttttacttggtggcggacagc
gaagaagacatgaacaagtgggtccgttgtatctgtgacatctgtgggttcaatcccaca
gaagaagatcccgtgaggccgctggccagctcctcacaagcacctgctgattcaccgttc
gccataaatacagcaccagcctccgcccacatggaaccatcttcagtcgcgctacctccc
tcttaccaactcatcagcctcccaccacacccagacactctcggcctccgggaggacccg
caagactacctcttgctgatcaactgtcagagcaagaagcctgaacccaccagagcccat
tttgactctgccaaacccacctcttctgagacagactgcaatgacaacgtcccttcccac
aagcctcctgcttcctcccagggcaaacacggaatgaacggcttttttcagcagcaaatg
gtgtatgactgcccaccaccgcgggttacatcggtctctggcgagtccggcctctataac
ctgcccaggagctactcccatgacgtactaccgaaggagtccccgtcaagtaccgaggca
gatggagagctttacgtttttaatacaccgtctgggacttcaagtgtagaagctcagatg
agacatgtgtctattagttacgacattccgccaacacctggcaacacttaccaggtccca
cggacatttccagaaggcacactgggacagtcatcgaagctggacactattcctgacgtc
cccccacctcggccaccaaagccacattcaactcatgaccggtctcctgtggagacgtgc
ggagtgccacgcacggcatcagacactgacagcagttactgtatccctccggcaggcatg
ccgccctcccggagtaacaccatttccaccgtggatctgaacaagttacggaaagatgct
ggttctcaagattgctatgatattccacggaccttcccgagcgatagatccagttccttg
gaaggcttccataaccagttgaaaatcaagaatgtgctggctgcgggcaatgtctcggga
gaagagctggacgagaactacgttcccatgaaccccaactcgccaccacgccaccatccc
agcagcttcgccgaaccgattcaggaaccaaactacgtgccaatgacccctgggaccttt
gatttttctgcgtttgggatgcaagtccctcctcctgctcatctgggcttcaggtccagc
ccaaagacccctcccaggaggccagttcccgttgctgactgtgaaccacccccggtggat
aggaacctcaagccagacagaaaagttaagccggcacctttagaaatcaagcctctgtca
gagtgggaggagctgcaggccccagtcagatcccccatcaccaggagcttcgctcgggac
tcctctaggtttcccatgtcccctcggcctgattctgtgcacagcacgacatcgagcagt
gactcccatgacagtgaagagaactatgtccccatgaacccaaatctgtccaacgaagat
cagaatctcttttgcaacaacagcctcgagggggcgagcagccctatgaccaaacccaaa
ggagataaacaagtcgaatacctggatttagacctagaatctgggaagtccacaccacca
cggaagcaaaagaacagtggttcgggcagcagcatgtctgacgagcgggtggattacgtc
gtggtggaccaacagaagactctggccctgaagagtaccagggaagcttggacggacggc
aggcagtccacagagtccgagacacccaccaagaatgtgaagtga

DBGET integrated database retrieval system