KEGG   Rattus norvegicus (rat): 361399Help
Entry
361399            CDS       T01003                                 

Gene name
Edc4, LRRG00115, Nrn1l, RGD1309136
Definition
(RefSeq) enhancer of mRNA decapping 4
  KO
K12616  enhancer of mRNA-decapping protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    361399 (Edc4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361399 (Edc4)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     361399 (Edc4)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     361399 (Edc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ge1_WD40 WD40
Motif
Other DBs
NCBI-GeneID: 361399
NCBI-ProteinID: NP_001028240
RGD: 1562009
Ensembl: ENSRNOG00000024025
UniProt: Q3ZAV8
Position
19q12
AA seq 1407 aa AA seqDB search
MASCASIDIEDATQHLRDILKLDRPAGGSNVESQRPSSAYNGDLNGLLVPDPLSSGDGNS
TSKPGIRTMPPINLQEKQVICLSGDDSSTCIGILAKEVEIVASSDSSISSKARGSNKVKI
QPVAKYDWEQKYYYGNLIAVSNSFLAYAIRAANNGSAMVRVISVSTSERTLLKGFTGSVA
DLAFAHLNSPQLACLDEAGDLFVWRLALVKGKIQEEILVHIRQPEGTPLNHFRRIIWCPF
IPEESEDCCEESSPTVALLHEDRAEVWDLDMLRSSHSTWPVDVSQIKQGFIVVKGHSTCL
SEGALSPDGTVLATASHDGFVKFWQIYIEGQDEPRCLHEWKPHDGRPLSCLLFCDNHKKQ
DPEVPFWRFLITGADQNRELKMWCTVSWTCLQTIRFSPDIFSSVSVPPSLKVCLDLSAEY
LILSDVQRKVLYVMELLQNQDEGRACFSSISEFLLTHPVLSFGIQVVSRCRLRHTEVLPA
EEESDSLGTESSHGAGTLESAAGVLIKLFCVHTKALQDVQIRFQPQLNPDVVAPLSTHTA
HEDFTFGESRPELGSEGLASAPHGSQPDLRRIVELPAPADFLSLSSETKPKLMTPDAFMT
PTASLQQISASPSSSSSSSSSSSSSSSSSSSSSLTAVSAVSSSSAMDPSLPSRPPEELTL
SPKLQLDGSLTISSSSSLQASPRSLLPGLLPGPADKLIPKGPGQVSSGTSALSLDLQEVE
PLGLPQASPSRTRSPDVISSASTALSQDIPEIASEALSRGFGSSVPEGLIEPDSMASAAS
ALHLLSPRPRQGPELSSQLGLDGGPGDGDRHSTPSLLEAALTQEVATSDSQVWPTAPDIT
RETCSTLTESPRNGLQEKHKSLAFHRPPYHLLQQHDSQDTSAEQSDHDDEVASLASASGG
FGSKIPTPRLPAKDWKTKGSPRTSPKLKRKSKKDDGDSAVGSRLTEHQVVEPPEDWPALI
WQQQRELAELWHNQEELLQRLCAQLEGLQSTVTDHVERALETRHEQEQRRLERALAEGQQ
RGGQLQEQLTQQLSQALSSAVAGRLERSIRDEIKKTVPPCVSRSLEPVAGQLSNSVATKL
TAVEGSMKENISKLLKSKNLTDAIARAAADTLQGPMQAAYREAFQSVVLPAFEKSCQAMF
QQINDSFRLGTQEYLQQLDSHMKSRKAREQEAREPVLAQLRGLVSTLQNATEQMAATVSS
SVRAEVQHQLHVAVGSLQESILAQVQRIVKGEVSVALKEQQATVTSSIMQAMRSAAGTPV
PSAHLDCQAQQAHILQLLQQGHLNQAFQQALTAADLNLVLYVCETVDPAQVFGQPPCPLS
QPVLLSLIQQLASDLGTRSDLKLSYLEEAVMHLDHSDPITRDHMGSVMAQVRQKLFQFLQ
ADPHNSLGKAARRLSLMLHGLVTPSLP
NT seq 4224 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctgcgcgagcatcgacattgaggacgccacgcagcatctgcgggacatcctc
aaactggaccggcccgccggaggctccaatgtcgaaagccaaaggccatccagtgcctac
aatggagacctcaatgggctcctggtcccagatccgctcagttcaggagatggtaactcg
acaagcaaacctggtatacggaccatgccacccattaatctgcaggaaaagcaggtcatt
tgcctctctggagatgacagctccacgtgcattgggattttggccaaggaggtagaaatt
gtggccagcagtgattctagcatttccagcaaggcgcgagggagcaacaaggtgaaaatc
cagcctgtagccaagtatgactgggagcagaaatactactatggcaacctgattgcagtg
tctaactccttcttggcatacgccatcagggctgccaacaatggctcagccatggtccga
gtgatcagtgtgagcacttcggagcggaccctgctcaagggcttcacaggcagtgtggct
gaccttgcatttgcacacctcaactctccacagcttgcctgcctggacgaggccggcgat
ctctttgtgtggcgactggctctggttaagggcaaaattcaagaagagatcttagtccat
atccggcaaccagagggcacaccactgaaccacttccgaaggatcatctggtgccctttc
atccctgaggaaagcgaggactgttgtgaggagagtagcccaacggtggccctgctgcat
gaagaccgggctgaggtgtgggacttggatatgcttcgctccagccacagcacatggcct
gtggatgtcagccaaatcaagcagggctttatcgtggtaaaaggccatagcacgtgccta
agtgaaggagccctttcccctgatgggactgtgctggccaccgcaagccatgatggcttt
gtcaagttctggcagatctatattgaaggtcaggatgagccaaggtgtctgcatgaatgg
aaacctcatgatgggcggcctctttcttgcctcctgttctgtgataaccataagaaacag
gatcctgaggtcccattctggaggttcctcattactggcgctgaccagaatcgagagctg
aagatgtggtgcacagtgtcctggacctgcctgcaaaccattcgcttctccccagatatc
ttcagttcagtgagtgtgcctcccagtctcaaagtttgcttggacctctcagcagaatat
ttgattcttagtgatgtgcaacgaaaggtcctctatgtgatggagctgctgcagaaccag
gacgagggccgtgcttgcttcagttccatctctgagttcctgctcacccaccctgtgctg
agctttggcatccaggttgtgagtcgctgccggctgcggcacactgaggtgctgcctgct
gaggaggagagtgacagtctggggactgagagttcccatggagctggtaccttggaatct
gcagctggtgtgcttatcaagctcttttgtgtgcacactaaggcactccaagatgtgcag
atccgcttccagccacagctgaaccctgatgtggtggccccactctctacccacactgct
catgaggacttcacatttggagagtctcgacctgaactaggctctgaggggctagcttca
gctcctcatggttcccagcctgacctccgacgcattgtggagctgcctgcacctgcagac
ttcctcagtctgagcagtgagaccaagcctaagttgatgacacctgatgctttcatgaca
cctaccgcctccctgcagcagatctctgcatcccctagtagtagcagcagcagtagcagc
agcagcagtagcagcagcagcagtagcagcagcagctctctaacagctgtgtctgctgtg
agcagctcctcagccatggacccctccttgcccagtaggccacccgaggaactgaccttg
agccccaaactgcagctagatggcagcctgactataagcagcagcagcagcctgcaggca
agccctcggagccttcttccgggcctgctcccaggcccagctgacaaactaattcccaag
ggacctggtcaggtatcttctggtacttctgcactatccttggatttgcaggaagtggaa
ccattagggctaccccaggcctccccaagtcgcacacgttctcctgatgtgatctcctca
gcatccactgccctgtcccaggacatccctgaaattgcatctgaggccctgtcccgtggc
tttggctcctctgtacctgagggcctcattgagccagacagcatggcctcagctgcctca
gcactacacctactgtctcctcggcccaggcaaggccctgagcttagttctcagcttggt
ctagatggaggccctggggatggggataggcatagtaccccttccctactggaagcagcc
ttgacccaggaagttgcaacctctgacagtcaagtctggcctacagcacctgacattact
cgtgagacctgtagcacactaacagaaagccccaggaatggcctccaggaaaagcacaaa
agcctggccttccacaggccaccttatcacctgctgcagcaacatgacagtcaggacaca
agtgctgagcaaagtgaccatgacgatgaggttgccagccttgcctctgcttcaggaggt
tttggcagcaaaattcctactccacggctgcctgccaaggattggaaaaccaagggatcc
cctaggacttcacctaagctcaagaggaaaagcaagaaggatgatggggattcagctgtg
ggatctcggctcaccgagcaccaggtggtagagccccctgaagactggccagcactaatt
tggcagcagcaaagagagctggcagaactatggcacaaccaagaagagctgctacagcgt
ctttgtgcccaacttgaaggtcttcagagcactgtcacagaccatgtagaacgtgccctg
gagacacggcatgagcaagagcaacggcgactggagcgggcactggctgaggggcagcaa
cggggtgggcagctacaggagcagctgacacagcagctatcccaggctttgtcttcagct
gtggctgggcggctagagcgcagcataagggatgaaatcaagaaaacagttcctccatgt
gtctccagaagtctggagcctgtggcaggccaactaagcaactcagtggctaccaagctt
acagctgtggaaggcagcatgaaagagaatatctctaagctactcaagtccaagaactta
acagatgccattgcccgcgcagctgcagatacgctacagggaccaatgcaggctgcctac
cgagaagccttccagagtgtggtgctgccggcttttgagaagagttgtcaggctatgttc
cagcaaatcaatgacagcttcaggctgggcactcaggaatatttgcagcagctggacagt
cacatgaagagccgaaaggcacgtgaacaagaagctagggagcctgtgttggcccagctt
cggggcctggtcagcacactgcagaatgccactgagcagatggcagccactgtgtctagc
agtgttcgggccgaggtgcaacaccagctgcatgtggctgtgggcagcttgcaggaatca
atcttagcacaagtacaacgcattgtcaagggtgaagtgagtgtggcactgaaggagcag
caggccactgtcacttccagcatcatgcaggctatgcgctcagctgctggcacacctgtc
ccctctgcccaccttgactgccaggcccaacaagcccatatcttgcagttactgcagcag
ggccacctcaatcaggccttccagcaggctctgactgctgctgatctcaacctggtgctg
tatgtgtgtgaaactgtggacccagcccaggtttttgggcagccgccctgtccactgtcc
cagcccgttctcctttccctaatccagcagctagcatctgaccttggaactagaagtgac
ctcaagctcagctacttggaagaggctgtgatgcacctggaccacagcgatcccatcact
cgagaccacatgggctctgtcatggctcaggtgcgccagaagctcttccagttcctgcag
gctgatccacacaactcacttggcaaagctgcccgccgcctcagcctaatgttacacggc
cttgtgacccctagcctcccttag

DBGET integrated database retrieval system