KEGG   Rattus norvegicus (rat): 361400Help
Entry
361400            CDS       T01003                                 

Gene name
Nfatc3, NFAT4
Definition
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04625  C-type lectin receptor signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04921  Oxytocin signaling pathway
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    361400 (Nfatc3)
   04310 Wnt signaling pathway
    361400 (Nfatc3)
   04022 cGMP-PKG signaling pathway
    361400 (Nfatc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    361400 (Nfatc3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    361400 (Nfatc3)
   04660 T cell receptor signaling pathway
    361400 (Nfatc3)
   04658 Th1 and Th2 cell differentiation
    361400 (Nfatc3)
   04659 Th17 cell differentiation
    361400 (Nfatc3)
   04662 B cell receptor signaling pathway
    361400 (Nfatc3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    361400 (Nfatc3)
  09158 Development
   04360 Axon guidance
    361400 (Nfatc3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    361400 (Nfatc3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    361400 (Nfatc3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    361400 (Nfatc3)
   05170 Human immunodeficiency virus 1 infection
    361400 (Nfatc3)
   05161 Hepatitis B
    361400 (Nfatc3)
   05163 Human cytomegalovirus infection
    361400 (Nfatc3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    361400 (Nfatc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361400 (Nfatc3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    361400 (Nfatc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Motif
Other DBs
NCBI-GeneID: 361400
NCBI-ProteinID: NP_001101917
RGD: 1308692
Ensembl: ENSRNOG00000054264
UniProt: D3ZU59
Position
19q12
AA seq 1068 aa AA seqDB search
MTTANCGAHDELDFKLVFGEDGAPTPVSQVSRPADLEPDDCASIYIFNVDPPPSTLNSSL
GLPHHGLLQSHSSVLSPSFQLQGFKNYEGTDDISESKYSSLSGPKPFECPSIQITSISPN
CHQETDAHEDDLHVNDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSVSSRSWFSDA
SSCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGPGHSLSPRQ
SPCHSPRSSITDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGH
SPRGSVTEDTWLTAPVHTGSGLSPAPFPFQYCVETDIPLKTRKTSDDQAAILPGKLEVCS
DDQGSLSPSRETSVDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPP
LDWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQ
MFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAG
ILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQEL
PHIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPHWEAEGKIIREKCQGGH
IVLEVPPYHNPAVTSAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEQREDTDLSSVPSLP
VPHSAQTQRPSSDTGHPHDSALSAPRSLICPVQPAYASMITSTHLPQLQCRDEGAGKEQH
IIPSSVMHQPFQVTPTSPMGSSYQSIQTNMYNGPTCLPMNPASSQEFDPVLFQQDAALSN
LVNLGCQPLSPIPFHSSNSDATGHLLAHSPHSVQTPPHLQSMGYHCSSAGQRSLSSPVAA
QVTGQPSSHLQPITYCPSHPGSATAASPAASHALSSSPISGPPSPQLQSMPYQSPSSGTA
SSPSPVTRMHSGQHSTQAQSTGQGGLSVPSSLVCHSLCDPASFPPGGAAVSIKPEPEDQE
PNFATIGLQDITLDDDQFMSDLEHQPSGSTEKWPNHSEFSCPVPFWRI
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgactttaaactcgtcttcggcgag
gacggggcaccaacgccggtgtcccaggtctcgcggcctgcagatcttgaaccagatgat
tgtgcatccatttacatctttaatgtagacccgcctccatctactttaaattcatcactt
ggcttaccacatcatggactgctgcagtctcactcttctgttttgtcaccatcatttcag
ctccaaggtttcaaaaattatgaaggaactgatgatatttctgaatctaaatatagctca
ttaagtggtcctaaaccctttgaatgcccaagtattcaaattacatccatctctcctaac
tgtcatcaagaaacagatgctcatgaagatgacctacatgtaaatgacccagaaagggaa
tatttggaaaggccttctagagatcatctctatctcccacttgaaccgtcctaccgggaa
tcttcccttagtcctagtcctgccagcagcgtttcttctaggagttggttctcagatgca
tcttcttgtgagtctctctcacacatttatgacgatgtggactcagagttgaatgaagct
gctgcacgatttactcttggctcacctctgacttctccaggtggctctccaggaggttgc
cctggagaagagtcctggcatcaacagtatggacctggacattccttgtcacctaggcaa
tctccttgccactctcctagatccagtatcactgatgagaattggctgagccccagacca
gcctcaggaccctcatccaggcccacttctccttgtggtaaacgacggcactccagtgct
gaagtatgttatgctggctctctttcaccccatcactcacctgttccgtcccctggtcac
tcgcctagagggagtgtaactgaagatacctggctcactgctcctgtccacactggatca
ggcctcagccctgcaccgtttccatttcagtactgtgtagagactgacatccctttgaaa
acaaggaagacttctgacgatcaagctgccatactaccaggaaaattagaggtctgttca
gatgatcaagggagcttatccccatcccgggagacatcagtagatgatggccttggatct
cagtatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcacctttt
acctggagcaaaccaaagcctggccacactcctatatttcgcacatcttcattacctcca
ttagactggcctttaccaactcactttggacaatgtgaattgaaaatagaagtgcaacct
aaaactcaccatagagcccattatgaaactgaaggtagccgaggggcagtgaaagcctct
actggtggccatcctgttgtgaagctcctgggctatagtgaaaagccaataaatctacag
atgtttattggaacagccgatgatagatatttacgacctcacgcattttaccaggtgcat
cgcattactggaaagacagttgctactgcaagtcaagagataataatcgccagcacaaaa
gttctggaaatcccacttctacctgaaaataatatgtcagcaagtatcgactgtgcaggt
attttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcaga
aagaatactagagtccgacttgtatttcgtgtgcacatcccacagcccagtggaaaagtc
ctttctctacagatagcatctattcctgttgagtgctctcagcgatctgctcaagagctc
cctcacattgagaagtacagtatcaacagctgctctgtcaatggaggccacgaaatgatt
gtgactggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagat
ggaagacctcattgggaggctgaaggaaaaataatcagagaaaaatgtcaagggggtcat
attgtccttgaagttcctccctatcataacccagcagttacatctgctgtgcaggtgcac
ttttatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttacacacca
gttttgatgaagcaagaacaaagagaagatactgatttgtcttcagttccatccttgcct
gtgcctcattctgcccagacccagaggccttcctcagatacagggcacccccatgacagt
gcattgtctgcaccaagaagcttgatttgtccagtgcagccagcatatgcatctatgata
acctccacccatttgccacagttgcaatgtagggatgagggtgctggcaaagaacagcac
ataataccatcttcggtcatgcaccagccttttcaagttacaccaacatctcctatgggg
tcttcctatcagtctatacaaactaatatgtataatggtccaacttgtcttcctatgaat
cctgcctctagtcaagaatttgatccagttttgtttcagcaggatgcagctctttctaat
ttagtaaatcttggctgtcaaccactgtcaccaataccatttcattcttcaaattcagat
gcaacaggacatcttttagctcattcacctcattctgtgcaaaccccacctcatctgcag
tcaatgggataccattgttcaagtgcaggacaaagatctctttcttctccagtagcagcc
caggtcacaggtcagccttcttcccatttacagcctatcacatattgtccttcacatcca
gggtctgctacagcagcttccccagcagcctctcatgctctttctagttcaccgatttct
gggccaccgtcccctcagctgcagtctatgccttaccaatctcctagctcaggaactgcc
tcatcaccatctccagttaccagaatgcattctggacagcactcaactcaagcacaaagt
acagggcaaggaggtctttctgtaccttcatccttagtttgtcacagtttgtgtgaccca
gcatcgtttccacctggtggtgcagctgtgagcattaaacctgaacctgaagatcaagaa
cctaactttgcaaccattggtctacaggatatcactttagatgatgaccagtttatgtct
gacttggaacaccagccatcaggttcaacagagaaatggcctaatcacagtgagttctca
tgtccagttcctttctggcgaatctag

DBGET integrated database retrieval system