KEGG   Rattus norvegicus (rat): 361401
Entry
361401            CDS       T01003                                 

Gene name
Pla2g15
Definition
(RefSeq) phospholipase A2 group XV precursor
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    361401 (Pla2g15)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    361401 (Pla2g15)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     361401 (Pla2g15)
SSDB
Motif
Pfam: LCAT Abhydrolase_6 DUF915 Abhydrolase_1 Hydrolase_4 FGase
Other DBs
NCBI-GeneID: 361401
NCBI-ProteinID: NP_001004277
RGD: 1302982
Ensembl: ENSRNOG00000019859
UniProt: Q675A5
Position
19
AA seq 413 aa
MDRHLCICREIQLRSGLLFPFLLLMMLADLALPAQRHPPVVLVPGDLGNQLEAKLDKPKV
VHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGE
TFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEM
IEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQ
DIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGD
GTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggatcgccatctctgcatttgtcgcgagatccagctccggagtggcctcctgttccct
tttcttctactaatgatgctggcagacctagcgctcccggcccaacgtcaccccccggtg
gtgctggtgcctggtgatttgggtaaccagttggaagcaaagctggataagccaaaggtt
gtacactacctgtgctccaagaggacggacagttacttcacactctggctgaatcttgaa
ctgctcctgccagttatcattgactgctggattgacaatatcaggctggtttacaacaga
acatctcggactacccagtttcctgatggtgtagatgtgcgtgttcctggctttggggaa
acattttctctggaattcctagacccaagcaaaaggaacgtgggttcctatttctacact
atggtggagagtcttgtgggctggggctacacacggggggaagatgtccgtggtgctccc
tatgattggcgcagagccccaaatgaaaacgggccttacttcttggccctccaagagatg
atcgaggagatgtaccagatgtatgggggccccgtggtgctggtcgcccacagcatgggc
aacatgtacatgctctactttctgcagcggcaaccacaggcctggaaggacaagtatatc
caagccttcgtctcactgggtgcgccctgggggggcgtggccaagaccctgcgtgtcctg
gcctcaggagacaacaaccgtatccctgtcattgggccactgaagatccgggaacagcag
cgatctgcagtctccaccagctggctactgccgtacaaccacacgtggtcacatgaaaag
gtgtttgtgtacacacccacagctaactacacactccgggactatcaccggttcttccaa
gacatcggctttgaagacggctggttcatgaggcaggacacacaagggctggtggaagcc
ctggtaccgcctggtgtagagctgcactgcctgtacgggaccggtgttcccacaccaaac
tctttctactacgagaactttcctgatcgtgacccaaaaatctgctttggggatggtgac
ggcacagtgaacttggagagtgtcctgcagtgccaagcctggcagagccgccaagagcac
aaagtgtcattgcaggagctgccagggagcgaacacattgagatgctggccaatgccact
accttggcttatctgaaacgtgtgcttctagaagaaccttga

DBGET integrated database retrieval system