KEGG   Rattus norvegicus (rat): 361413Help
Entry
361413            CDS       T01003                                 

Gene name
Nudt7
Definition
(RefSeq) nudix hydrolase 7
  KO
K17879  peroxisomal coenzyme A diphosphatase NUDT7 [EC:3.6.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    361413 (Nudt7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     361413 (Nudt7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 361413
NCBI-ProteinID: NP_001292355
RGD: 1306719
Ensembl: ENSRNOG00000011976
Position
19q12
AA seq 236 aa AA seqDB search
MPRPCGLQESVRNNLIDDAKARLKKFDVGTRYSHLSPSKYSVLLPLLARGEKLYLLFTVR
SDKLRRAPGEVCFPGGKRDPVDADDTATALREAQEEVGLHPHQVEVVSHLVPYFINNNDL
VTPVVGFLDPDFQAQPNADEVKDVFLVPLDYFLCPQVYYQSHFTHSGYHFVLHCFEYTDP
ETGSKYLIKGMTSKLAVLAALIIFEKSPSFETEFDLHDLIPSCEKTFLHRCSSSKL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaccttgtggactccaggagtctgtcagaaacaatctgattgacgatgccaag
gctcgcttgaaaaagtttgatgttgggaccagatattcccacttgtcccctagtaagtat
tctgttcttctgccattgctggccagaggagaaaagctgtacttgctgttcacggtccgc
tcagacaagctgagaagggcacctggagaagtctgcttccctggaggaaagagggaccca
gtggatgcagatgacacagcgactgctctccgtgaagcccaggaggaggtggggctgcat
ccccaccaagtggaggtggtctctcacctggtgccatattttattaataacaatgacctg
gtaacgcccgtagtgggatttctagaccccgacttccaggcccagcctaatgctgatgaa
gtgaaggatgtgttcctcgtgcctttggactatttcctctgtccccaagtctactaccag
agtcacttcacacattctggctaccattttgttttgcattgctttgaatacacagaccct
gagactggctcgaagtacctcatcaagggaatgacctcaaaattggctgtgctggctgcc
ttaattatttttgaaaaaagtccttccttcgagaccgaatttgatctccatgacctgata
ccatcttgtgagaagacctttcttcatagatgttcttccagcaaattgtga

DBGET integrated database retrieval system