KEGG   Rattus norvegicus (rat): 361430
Entry
361430            CDS       T01003                                 

Gene name
Piezo1, Fam38a, Mib
Definition
(RefSeq) piezo-type mechanosensitive ion channel component 1
  KO
K22128  piezo-type mechanosensitive ion channel component 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361430 (Piezo1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    361430 (Piezo1)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    361430 (Piezo1)
Ion channels [BR:rno04040]
 Other channels
  Mechanosensitive channel (Piezo)
   361430 (Piezo1)
SSDB
Motif
Pfam: Piezo_RRas_bdg PIEZO
Other DBs
NCBI-GeneID: 361430
NCBI-ProteinID: NP_001070668
RGD: 1308822
Ensembl: ENSRNOG00000056786
UniProt: Q0KL00
Position
19q12
AA seq 2535 aa
MEPHVLGAGLYWLLLPCTLLAASLLRFNALSLVYLLFLLLLPWLPGPSRHSIPGHTGRLL
RALLCLSLLFLVAHVAFQICLHTMPRLNQLLGQNCNLWANVSQHIGVTRLDLKDIFNTTR
LVAPDLGVLVASSLCLGLCGRLTRKARQSQRTQELEEDDIDAAPAAGLQGAPTLATKRRL
WLAPRFRITAHWLLVTSGRMLVIVLLALAGIAHPSAFSSVYLMVFLAICTWWSCHFPLSS
LGFNTLCVMVSCFGAGHLVCLYCYQTPFVQSVLLPGSLWARLFGLKNFVDIPNCSSPNVL
VLNTKHAWPIYVSPGILLLLYYTATSLLKLRKGRFSELRKEIPREDEEHELELDQLEPEP
QARGTTQGATPTTTGPDIDNCTVHVLTSQSPVRQRPVRPRLAELKEMSPLHGLGHLILDQ
SYVCALIAMMVWSIMYHSWLTFVLLLWACLIWTVRSRHQLAMLCSPCILLYGLTLCCLRY
VWAMELPELPTTLGPVSLHQLGLEHTRYPCLDLGAMLLYLLTFWLLLRQFVKEKLLKKRK
APSTLLEVTVSDTEPTQTQTLLRSLGELVTGIYVKYWIYVCAGMFIVVSFAGRLVVYKIV
YMFLFLLCLTLFQVYYTLWRKLLRVFWWLVVAYTMLVLIAVYTFQFQDFPTYWRNLTGFT
DEQLGDLGLEQFSVSELFSSILIPGFFLLACILQLHYFHRPFMQLTDLEHVPPPGTRRLR
WAHRQDTVSEAPLLQHQEEEEVFRDDGQSMDGPHQTTQVPEGTASKWGLVADRLLDLASS
FSAVLTRIQVFVRCLLELHVFKLVALYTVWVALKEVSVMNLLLVVLWAFALPYPRFRPMA
SCLSTVWTCIIIVCKMLYQLKIVNPHEYSSNCTEPFPNNTNLQPLEISQSLLYRGPVDPA
NWFGVRKGYPNLGYIQNHLQILLLLVFEAVVYRRQEHYRRQHQQAPLPAQALCADGTRQR
LDQDLLSCLKYFINFFFYKFGLEICFLMAVNVIGQRMNFMVILHGCWLVAILTRRRREAI
ARLWPNYCLFLTLFLLYQYLLCLGMPPALCIDYPWRWSQAIPMNSALIKWLYLPDFFRAP
NSTNLISDFLLLLCASQQWQVFSAEQTEEWQRMAGVNTDHLEPLRGEPNPIPNFIHCRSY
LDMLKVAVFRYLFWLVLVVVFVTGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQLVL
WDCLILYNVTVIISKNMLSLLSCVFVEQMQSNFCWVIQLFSLVCTVKGYYDPKEMKTRDR
DCLLPVEEAGIIWDSICFFFLLLQRRVFLSHYFLHVSADLKATALQASRGFALYNAANIK
NINFHRQTEERSLAQLKRQMKRIRAKQEKYRQSQASRGQLQSTDPQEPGPDSPGGSSPPR
TQWWRPWQDHATVIHSGDYFLFESDSEEEEEALPEDPRPAAQSAFQMAYQAWVTNAQTVL
RQRREQARRDRAEQLASGGDLSPEVELVDVPENEMAGHSHVMQRVLSTMQFLWVLGQATV
DGLTRWLRTFTKDHRTMSDVLCAERYLLTQELLRGGEVHRGVLDQLYVSEDEIALSGPVE
NRDGPSTASSGLGAEEPLSSMTDDTGSPLSTGYNTRSGSEEIITDTGGLQAGTSLHGSQE
LLANARTRMRTASELLLDRRLRIPELEEAEQFEAQQGRTLRLLRAMYQCVAAHSELLCYF
IIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFQFGFFP
WNSYIVLRRYENKPYFPPRILGLEKTDSYIKYDLVQLMALFFHRSQLLCYGLWDHEEDGV
PKDHCRSSEKDQEAEEESEAKLESQPETGTGHPEEPVLTGTPKDHIQGKGSVRSKDEIQD
PPEDLKPQHRRHISIRFRRRKETQGPKGAAVVEAEHEEGEEGREAAGRKRLRRPREGLKI
REKMKAAGRRLQSFCLSLAQSFYQPLRRFFHDILHTKYRAATDVYALMFLADIVDIVVII
FGFWAFGKHSAATDIASSLSDDQVPQAFLFMLLVQFGTMVIDRALYLRKTVLGNLAFQVV
LVVAIHLWMFFILPAVTERMFRQNAVAQLWYFVKCIYFALSAYQIRCGYPTRILGNFLTK
KYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETE
KKYPQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSLIRSVVGVVNQPIDVTVTLKL
GGYEPLFTMSAQQPSIVPFTPEDYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGA
LWRISPPSRAQMKHELYNGTADITLRFTWNFQRDLAKGGSVEYTNEKHTLELAPNSTARR
QLAQLLEGRPDQSVVIPHLFPKYIRAPNGPEANPVKQLQPDEEEDYLGVRIQLRREQVGT
GTSGEQAGTKASDFLEWWVIELQDCQAECNLLPMVIFSDKVSPPSLGFLAGYGIVGLYVS
IVLVVGKFVRGFFSDISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFL
YRSPETMIKWTREKE
NT seq 7608 nt   +upstreamnt  +downstreamnt
atggagccgcacgtgctgggcgccgggctctactggctgttgctaccctgcacactcctg
gcggcctccctgttacgcttcaatgctctctcgttggtctatttgctgtttctactgctg
ctaccctggcttccaggcccctcaagacacagcataccaggtcacacaggtcgcctgctt
cgtgcactactctgcctcagcctcctcttcctggtggcccatgttgccttccagatatgc
ctacataccatgcctcgcctgaaccagcttctgggacaaaactgtaacctttgggcaaac
gtgtctcaacacataggggttacaaggctggacctgaaggacatctttaacaccaccaga
ctggtggcacctgacctgggagtgctggtggcatcttccctttgccttggcctctgtgga
cgcctcacaaggaaagcccggcagagccagcgcactcaggagctggaggaggatgacata
gatgctgcccccgccgcagggctgcagggagcccccaccctggcaaccaaacgcaggctg
tggctggcccctcgcttccggatcacggcgcactggctgctggtgacctccggacggatg
ctggtcatcgtgctactggcactcgcaggcatagcccatccttcggccttctccagcgtc
tacctgatggtgttcctggccatctgcacctggtggtcttgccactttcctctcagctcc
ctgggctttaacaccctctgcgtcatggtgagctgctttggcgccggccatcttgtttgt
ttatactgctatcagacaccatttgtccagagcgtgctacttcctggcagcctctgggcc
aggctatttggtctcaagaacttcgtagacatccctaactgctccagccccaacgtgctg
gtactcaacactaagcatgcttggcccatctacgtgagccccggtatcctgctgctgttg
tactacacagccacctctctcctgaagctccgcaagggccgcttctcagagctgaggaag
gagatcccgagggaggatgaggagcatgaactggaactggaccagctggagccagagccc
caggctaggggcaccacccagggtgcgacgcccacgaccactggacccgacattgacaac
tgcaccgtgcatgtactaaccagccagagccccgtccgccagcgtcctgtacgccccagg
ctggctgagctgaaagagatgtcaccactacatggcctgggccacctcatcctggaccag
agctatgtgtgtgctctgatcgccatgatggtgtggagcatcatgtaccacagctggctg
accttcgtcttgctgctctgggcctgcctcatctggaccgtgcgcagccgccaccagttg
gctatgctgtgctcaccctgcatcctgctgtacggactgacactctgctgcctgcggtac
gtgtgggccatggagctccccgagctgcccaccaccctgggccctgtcagtctacatcag
ttgggattggagcatacacgctacccctgcctggaccttggtgccatgctgctgtatctg
ctcacgttctggctgctcctgcgtcagttcgtgaaggagaagctgctgaagaagagaaag
gcaccttcgacgctgctggaggtcacagtgtccgacacagagcccacacagacccagaca
ctgctgaggagcctgggggagctggtcacgggcatctacgtcaagtactggatctacgtg
tgcgctgggatgttcattgtggtcagcttcgctggccgcctggtggtctacaaaatcgtc
tacatgttccttttcctgctgtgcctcacgttgttccaggtctactacactctgtggagg
aagctgctccgagttttctggtggctcgtggtggcctacaccatgctcgtgctcatcgcc
gtgtacactttccagttccaggacttccccacctactggcgcaacctcacgggcttcaca
gatgaacagttgggcgacctgggcctggagcagttcagcgtgtcggagctcttttccagc
atcctcatccctggcttcttcctgctggcctgcatcctgcagctgcactacttccacagg
ccgttcatgcagctcaccgacctggagcacgtgcccccgccaggcacacgccgccttcgc
tgggctcacaggcaggatacagtgagcgaggcccctctgcttcagcatcaggaggaggag
gaagtcttcagggatgacgggcagagcatggatgggccccaccagaccacacaggtccct
gagggtacagccagcaagtggggcctggtggccgaccggctgctggacctagcgtccagc
ttctccgccgtcctcacccgcatccaggtgttcgtacgatgtttgctcgagcttcacgtc
ttcaagctggtggctctctacactgtctgggtggccctgaaagaagtgtccgtgatgaac
ctgctgctggtggtgctgtgggccttcgccctgccctacccgcgcttccggcccatggcc
tcctgcctgtccaccgtgtggacctgtatcatcatcgtgtgcaagatgctgtatcagctg
aagattgtcaacccacacgagtactccagtaactgcaccgagccctttcccaacaatacc
aacttgcagcccttggagatcagccagtctctgctgtaccgtggccccgttgaccctgcc
aactggtttggggtgcggaagggttacccaaacttgggctatatccagaaccacctgcag
atccttctgctgctggtgtttgaggctgtggtgtaccggcgccaagagcactaccgccgg
cagcaccagcaggcccctctgcccgcccaggctttgtgcgctgatggcacccgccagagg
ctggaccaggacctactcagctgcctcaaatatttcatcaacttcttcttctacaaattc
gggctggagatctgcttcttgatggccgtgaatgtcatcggacaacgcatgaacttcatg
gtgatcttacacggctgctggttggtggccatccttacacgccggcgccgtgaggccatc
gcccgcctctggcccaattactgtctgttcctcacgctgttcctgctgtaccagtacctg
ctgtgcctgggcatgcctcccgcactgtgcatcgactacccgtggcgctggagccaggcc
atccccatgaattctgcgctcatcaagtggctgtacctccctgacttcttcagggccccc
aactccaccaaccttatcagtgacttcctcctgctactctgcgcctcccaacagtggcag
gtgttctccgcagagcaaacggaagaatggcagcgcatggctggcgttaacactgaccac
ctggagcccctgcgtggggagcccaaccctatccccaacttcatccactgcaggtcctat
ctggatatgctgaaggtggccgtcttccgctacctgttctggctggtgctggtggtcgtg
tttgtcacaggggccacccgcatcagcatctttgggctggggtacctgctggcctgcttc
tacctgctgctctttggcaccaccctgctgcagaaggacacacgagcccagctcgtgctg
tgggactgcctcatcctctacaacgtcaccgtcatcatctctaagaatatgttgtcgctc
ctgtcctgtgtcttcgtggagcaaatgcagagcaacttctgctgggtcatccagctcttc
agcctcgtgtgcacagtcaaaggctactatgaccccaaagagatgaagaccagggaccgg
gattgcctgctgcctgtggaggaggccgggatcatctgggacagcatctgcttcttcttc
ctgctcctacaacggcgcgtctttctcagccactacttcctgcacgtcagtgctgacctg
aaggccacggccctgcaggcctccaggggttttgctctctacaatgcggccaacataaag
aacatcaacttccaccgtcagaccgaggagaggtccctggcccagctgaaaagacagatg
aagcgcatccgtgccaaacaggagaaataccggcagagccaggcaagccgtggtcaactc
cagtccacagaccctcaggagccagggcctgacagcccagggggttcctccccgccacgg
acacagtggtggcgcccctggcaggaccacgccacagtcatccactctggtgactacttc
ctgtttgagtcggacagtgaggaggaagaggaggccctgcctgaggaccccaggcctgca
gctcagagtgccttccagatggcataccaggcatgggtaaccaacgcccagacagtgcta
aggcagcgtcgtgaacaggcacggcgggatcgggcagaacagctggcttctggaggcgac
ttgagtcctgaggtggagctggtagacgtcccagagaatgagatggcaggccatagccat
gtgatgcagcgcgtgctgagtaccatgcagttcctgtgggtgctgggccaggccacagtg
gacgggctgacgcgctggttgcgtacgttcacgaaggaccaccgcaccatgagtgatgtg
ctgtgtgcagagcgttacctgctcacccaggagcttcttcggggtggagaggtacaccga
ggggtactggaccagctttacgtgagcgaagatgagatcgcactgtcaggtcctgtggag
aaccgtgatggacccagcacagcctctagcgggctgggagctgaagagcctttgagtagc
atgacagacgacaccggcagcccccttagcactggctacaacactcgcagtggtagtgag
gagattatcaccgacactgggggcctccaggctgggacctccctgcacggctcccaagag
cttctagccaatgctcgtacccggatgcgcacagccagtgagctgctgctggacaggcgc
ctgcgtatccctgagctggaggaggccgagcagtttgaggcacagcagggccggacgctg
cggctgctcagagccatgtaccagtgtgtggcggcccactcagagcttctctgttacttc
atcatcatccttaaccacatggtgacagcctcggctgcctccctggtgctgcctgtgctt
gtgttcctctgggccatgctgaccatcccgaggcctagcaagcgcttctggatgacagct
atcgtcttcactgaggtcatggtggtcaccaaatacttgttccagtttggcttcttcccc
tggaacagctacatagtgcttcgacgctacgagaacaagccctacttccctccgcgcatc
ctgggcctcgagaaaacagacagctatatcaagtacgacctggtgcaactcatggccctc
ttcttccaccgctcgcagttactgtgctatggcctctgggaccatgaggaggatggtgtc
cccaaggaccattgcaggagtagcgaaaaggaccaggaagctgaggaagagtcagaggct
aagctggaatcgcagcctgagacgggcactgggcatcctgaggagcccgtgttgactggt
acccccaaggaccacatccaagggaaaggaagtgttaggtccaaggatgagatccaagat
cccccagaggaccttaagccccagcacaggagacacatcagcatacgcttcaggaggagg
aaggagactcaaggacccaaaggagcagcagtcgtggaggctgagcacgaggagggagag
gaaggaagagaagctgcagggagaaagaggctgcgtcgccctcgagaagggttgaagatt
cgggagaaaatgaaggcagctggacgccggctgcagagcttctgtctgtcactggcccag
agcttttaccaacccctgcggcgtttcttccatgacattctgcacaccaagtaccgagcg
gccaccgacgtctatgccctcatgttcctggctgacattgtcgacattgtcgtcatcatc
ttcggtttttgggcttttgggaagcactccgcggccacggacattgcatcctcactgtca
gatgaccaggtgccacaggccttcctgttcatgctgctggtccagttcggcaccatggtc
atagaccgcgccctctacctgcgtaagactgtactgggcaacctggcctttcaggtggtc
ctggtggtggccattcacctctggatgtttttcatcttaccggctgtcaccgagaggatg
ttcagacagaacgcggtggcccagctgtggtacttcgtgaagtgcatttactttgccctg
tccgcctaccagatccgctgtggctaccccacccgtatcttgggcaacttcctcaccaag
aagtacaatcatctaaacctcttccttttccaggggttccgtctagtgccattcctggtg
gagctgcgggccgtcatggactgggtatggactgacaccacgctgtccctgtccaactgg
atgtgtgtggaagacatctatgccaacatctttatcatcaagtgcagccgagagacagag
aagaaatacccccagcccaagggacagaagaagaagaaaatcgtcaagtatggcatggga
ggtctcatcatcctcttcctcattgccatcatctggttccctctgctcttcatgtcactg
atccgctctgtggttggtgtcgtcaaccagcccattgatgtcactgttaccctcaagtta
ggtggctacgagccactgttcaccatgagcgcccagcagccatccatagtgccattcact
cccgaggactatgaggagctgtcccagcagtttgacccctacccactagccatgcagttc
attagccagtacagtcctgaggacatcgtcactgcacagattgagggcagctcgggggcc
ctgtggcgcatcagcccgcccagccgggcccagatgaagcacgagctgtacaacggcaca
gccgacatcacactgcgcttcacctggaatttccaaagggacctggccaagggcggctct
gtggagtataccaacgagaagcacaccttggagctggcccccaacagtacggcacgaagg
cagctggcccaactgctcgagggcagacctgaccagtcagtggtcattccccacctcttc
cccaagtacattcgtgcacccaatgggcctgaagccaatcctgtgaagcaactgcagcca
gacgaggaagaggactaccttggtgtgcgtatccagctgcggagagagcaagtgggcaca
ggaacctctggggagcaagcaggcacaaaggcctccgacttcctcgagtggtgggtgatt
gagctgcaggactgccaggccgagtgcaacctgctgcccatggtcatcttcagtgacaag
gtcagcccgcctagcctgggcttcctggccggctacgggattgtggggctctacgtctct
atcgtgctggtcgttggcaagtttgtgcggggcttcttcagtgatatctcacactccatc
atgttcgaggagctgccgtgcgtggaccgcatcctcaagctgtgccaggacatcttcttg
gtacgggagacccgcgagctggagctggaggaggaactctatgccaagctcatattcctg
taccgatcaccagagaccatgatcaagtggacgcgtgagaaggagtag

DBGET integrated database retrieval system