KEGG   Rattus norvegicus (rat): 361438
Entry
361438            CDS       T01003                                 

Gene name
Gas8
Definition
(RefSeq) growth arrest specific 8
  KO
K19942  growth arrest-specific protein 8
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361438 (Gas8)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    361438 (Gas8)
SSDB
Motif
Pfam: GAS
Other DBs
NCBI-GeneID: 361438
NCBI-ProteinID: NP_001034119
RGD: 1307817
Ensembl: ENSRNOG00000026964
UniProt: Q499U4
Position
19q12
AA seq 478 aa
MAPKRRGKKGKAKGNAVVDGVAPEDMSKEQVEEHVARIREELDREREERNYFQLERDKIH
TFWEITRRQLEEKKAELRNKDREMEEAEERHQVEIKVYKQKVKHLLYEHQNNLAEVKTEG
TVVMKLAQKEHRAQEGALRKDMRVLKVELKEQELANEVVIKNLRLKQAEEITKMRNDFER
QVREIEAKYDKKMKMLRDELDLRRKTEIHEVEERKNGQISTLMQRHEEAFTDIKNYYNDI
TLNNLALINSLKEQMEDMRKKEEYLEREMAEVSLQNKRLAEPLQRAKEEMSEMQKRLGNH
ERDKQILACTKARLKVTEKELKDLKWEHEILEQRFIKVQQEREELYRKFTAAIQEVQQKT
GFKNLVLERKLQALNAAVEKREVQFNEVLAASNLDPTALTLVSRKLEDVLESKNTTIKDL
QYELARVCKAHNDLLRTYEAKLLAFGIPLDNVGFKPLETAVIGQTLGQGPAGLVGAPT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcacccaaaaggagagggaagaaagggaaagccaaagggaatgcagtcgttgatggg
gtcgcaccagaggacatgtccaaggagcaggtggaggaacatgtcgcccgcatccgggag
gagctggaccgggagcgggaggagcgcaactactttcagctggagcgggacaaaatccac
accttctgggagatcacgcggaggcagctggaggagaagaaggctgagctgcgcaacaaa
gaccgggagatggaggaggccgaggagaggcaccaggtggagatcaaggtttacaagcag
aaagtgaagcaccttctgtacgaacaccagaacaatctggcagaggtgaagactgagggc
accgtggtcatgaagctggcccagaaggagcaccgcgcccaagagggcgctctgcgcaag
gacatgcgcgtgctgaaagtggagctgaaggagcaggagctggctaacgaggtggtgata
aagaacctgcgtctgaaacaagccgaggagatcaccaagatgcgaaatgactttgaaagg
caagttcgagaaatcgaggccaaatatgataaaaagatgaagatgcttcgagacgagctt
gacctgcggagaaagactgagatccacgaggtggaggagaggaagaacgggcagatcagt
acgctgatgcagcgtcatgaggaggccttcactgacatcaaaaactactacaatgacatc
actctcaacaacctggccctcatcaattccctcaaggagcagatggaggatatgaggaag
aaggaggagtacctggagagggagatggcggaggtgtctctgcagaacaagcggctggct
gagccgctgcagagagccaaggaggagatgagcgagatgcagaagagactggggaaccat
gagagggacaagcagatcctggcctgtacgaaggcacgtttgaaggtcactgagaaggag
ctgaaggacctgaagtgggagcatgagatcctggagcagaggttcatcaaggtgcagcag
gagagggaagagctctatcggaagttcactgcagccatccaggaggtgcagcagaagaca
ggcttcaagaacctggtgctggagcgtaagctgcaggcactgaatgctgctgtggagaag
agagaggtgcagttcaatgaggtgctggctgcctccaacctggaccctacagcactaaca
cttgtgtctcgcaaacttgaggacgttctagagtcgaagaataccaccatcaaggacttg
cagtatgagctggcccgagtctgcaaggcccacaacgacctgttgcgtacatatgaggca
aagttattggccttcgggatccccctggacaatgtggggttcaagcccctggagacagca
gtgattggacagacactgggacagggccctgcaggacttgtgggtgcgccgacatag

DBGET integrated database retrieval system