KEGG   Rattus norvegicus (rat): 361439
Entry
361439            CDS       T01003                                 

Gene name
Abcb10
Definition
(RefSeq) ATP binding cassette subfamily B member 10
  KO
K05657  ATP-binding cassette, subfamily B (MDR/TAP), member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    361439 (Abcb10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    361439 (Abcb10)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    361439 (Abcb10)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_29 AAA_22 AAA ABC_ATPase Zeta_toxin AAA_21 AAA_30 AAA_5 AAA_25 RsgA_GTPase AAA_33 APS_kinase AAA_15 AAA_23 DUF87 HHH_6
Other DBs
NCBI-GeneID: 361439
NCBI-ProteinID: NP_001012166
RGD: 1311222
Ensembl: ENSRNOG00000017993
UniProt: Q5FVL8
Position
19q12
AA seq 715 aa
MRAPPARALLLFPRRGPAVRAWAPAVSSRTWLASEWTPLVRAWTSLIHEPSPGLRFPVPL
SGLPGGVGRWATSSGIRRCWVLAGPRAAHPLFARLQGAAATGVRDLGNDSQRRPATTGRS
EVWKLLGLVRPERGRLSAAVGFLAVSSVITMSAPFFLGKIIDVIYTNPTEDFGDSLTRLC
AGLTCVFLCGAAANSIRVYLMQSSGQSIVNRLRTSLFSSILRQEVAFFDKTRTGELINRL
SSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLATFVLSVVPPISVLAVIYGRY
LRKLSKATQDSLAEATQLAEERIGNIRTIRAFGKEMTEVEKYTSRVDQLLQLARKEALAR
AGFFGAAGLSGNLIVLSVLYKGGLLLGSTHMTVGELSSFLMYAFWVGLSIGGLSSFYSQL
MKGLGAGGRLWELLERQPRLPFNEGIVLDEKTFQGALEFRNVHFTYPARPEVSVFQDFSL
SIPSGSVTALVGPSGSGKSTVVSLLLRLYDPSSGTVSLDGHDIRQLNPVWLRSKIGTVSQ
EPVLFSCSVAENIAYGADNLSSVTARQVERAAEVANAAEFIRSFPQGFDTVVGEKGVLLS
GGQKQRIAIARALLKNPKILLLDEATSALDAENEHLVQEALDRLMEGRTVLIIAHRLSTI
KNANFVAVLNQGKICEHGTHEELLLKPNGLYRKLMNKQSLLLHNGAEQFLEPAQA
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgcgcgcccctcctgccagggcgctgctgctgtttccgcgccggggccctgctgtgcga
gcttgggccccggccgtctcctctcggacatggttggcttctgagtggactccgctcgta
cgcgcgtggacctctctgatccacgagccgagcccgggcctccgctttcccgtgcccctt
tcggggctgcctggcggcgtgggacggtgggccacctcctcggggatccgcaggtgttgg
gtgctggcaggaccccgcgccgcgcatcccctgttcgccaggctccagggagcagcggcc
accggtgtgcgagaccttgggaacgactcgcagcggcggcccgcgacgaccgggcgctca
gaagtgtggaagctcctggggttggtgcgcccggagcgcgggagactgtcagctgcggtt
ggctttcttgccgtgtccagtgtcatcaccatgtcggcccccttcttcctggggaagatc
attgatgtcatctacaccaacccaaccgaggactttggcgacagcctgactcgcctctgt
gctgggctcacctgtgtgttcctgtgtggcgctgccgcgaacagcatccgtgtctacctc
atgcagtcttcaggtcagagcattgtgaacaggctgcgcacctcactcttctcctccatt
ctaaggcaagaggttgccttctttgacaagacccgcacgggcgagttgattaaccgcctc
tcttcggataccgcactcctgggccactccgtgaccgagaatctctctgacgggctgagg
gctgtggcccaggcctcggttggtgttggcatgatgttctttgtgtcaccaagtctggcc
acctttgttctgagtgtggtgccacctatctctgtcctcgctgtgatttacgggcgatat
ctacggaaactgtccaaagccacacaggactctttggcagaagccacacagctagctgag
gagcggattggaaacataagaaccatccgagcttttgggaaggagatgacagaagtggag
aagtacaccagccgagtggaccagttgctgcagctggcacggaaggaggccttggcacga
gccggcttctttggagcggctgggctctcgggaaacttgattgtgctgtctgtcctgtac
aaaggaggcctgttgctgggcagcacccacatgacagtgggcgagctctcttccttcctc
atgtacgctttctgggtcggactgagcatcggaggtctgagttcattctactcccagctg
atgaagggcctgggtgctggcgggcggctctgggagctgctggagagacaaccacggctg
ccttttaacgaggggatcgtgttagatgagaaaaccttccagggcgccctggagttcaga
aatgtgcatttcacgtaccctgctcgcccggaggtgtccgtgttccaggatttcagtctt
tccatcccatctggatctgtcacagcgctggttggccctagtggttctgggaaatcaacg
gtggtctcactcctgctgcggttgtacgaccccagttctggaacagtcagtcttgatggc
catgacattcgtcagctaaaccccgtctggctgagatccaagattgggacagtaagtcag
gagccagtcctgttctcctgctctgttgctgaaaacattgcctatggtgctgacaacctc
tcctcggtcacagcccggcaggtggagagggccgcagaagtggccaatgctgctgagttc
attcgtagcttcccacagggcttcgacactgtggtcggggagaagggtgtcctcctgtct
ggtgggcagaagcagaggatcgcaatagccagagctctgctgaagaaccccaaaattctt
ctcctcgatgaagcaaccagcgcactggatgccgaaaacgagcacctggtccaggaggcg
cttgaccggctgatggagggaagaaccgtgttgatcatagcccaccgcctctccaccatt
aagaacgccaatttcgttgccgtccttaaccaaggaaagatctgtgaacatgggacacat
gaggagctgcttttgaagcccaatgggctttacagaaaactgatgaacaagcagagtctc
ctgctacataacggggcagagcagttcctggaacctgcacaggcgtag

DBGET integrated database retrieval system