KEGG   Rattus norvegicus (rat): 361442
Entry
361442            CDS       T01003                                 

Gene name
Sipa1l2
Definition
(RefSeq) signal-induced proliferation-associated 1-like protein 2
  KO
K17702  signal-induced proliferation-associated 1 like protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    361442 (Sipa1l2)
SSDB
Motif
Pfam: SPAR_C Rap_GAP PDZ PDZ_6 bZIP_2
Other DBs
NCBI-GeneID: 361442
NCBI-ProteinID: NP_001009704
RGD: 1306269
Ensembl: ENSRNOG00000019791
UniProt: Q5JCS6
Position
19
AA seq 1722 aa
MSDPRPSQAEKHKLGRAASKFKDPSRAMQSDDYFARKFKAINGSMGPATLNTSSLSEGGG
GGGGPANGTPAVPKMGVRARVSEWPPKKDCSKDLACKTLWESRSQSSYESATSIIQNGQN
DQVDRQQEEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDITISDIDTEDVLDQHA
VNPNTGAALHREYGSTSSIDRQGLSGENVFAMLRGYRIESYDPKVTSSFGFPDFFPCDTA
ISPSLHAAAQISRGEFVRISGLDYMDGGLLMGRDRDKPFKRRLKSESVETSLFRKLRTVK
SEHETFKFTSDLEEGRLDRGIRPWSCQRCFAHYDVQSILFNINEAMATRASVGKRKNITT
GASAASQTPVPVGPAGGCESPLGSKEDLNSKENPDADEGDGKSNDLVLSCPYFRNETGGE
GDRRIALSRANSASFSSGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEH
VDLGAYYYRKFFYGKEHQNYFGIDENLGPVAVSIRREKVEDPREKEGSQFNYRVAFRTSE
LTTLRGAILEDAVPSTARHGTARGLPLKEVLEYVIPELSIPCLRQAANSPKVPEQLLKLD
EQGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDN
KTDSTGTHSLYTTYKDFELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIIFQEPGALPF
TPKNIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDF
LLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTTTVDTSAKFSFITLGAKKKE
RVKPRKDAHLFSIGAIMWHVVARDFGQSADIECLLGISNEFIMLIEKESKNVVFNCSCRD
VIGWTSGLVSIKIFYERGECILLSSVDNSSEDIREIVQRLVIVTRGCETVEMTLRRNGLG
QLGFHVNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKV
VIIQPHEDGSPRRGCSELCRIPMVEYKLDSEGTPCEYKTPFRRNTTWHRVPTPALQPVSR
ASPVPGTPDRLQCQPLLQQAQAAIPRSTSFDRKLPDGTRSSPSNQSSSSDPGPGGSGPWR
PQVGYDGCPSPLLLEPQGPGSVECDGSGDHEDLMEGGRLPETKWHGPPSKVLSSYKERAL
QKDGSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIK
GASTDSGIDTTPCMPATILGPMHLTGSRSLIHSRAEQWADAADVSGADEDPAKMYTLHGY
ASAISSSAADGSMGDLSEVSSHSSGSHRSGSPSTHCSKSTGSLDSSKVYIVTHSGGQQVP
GAVAKPYHRQGAANKYVIGWKKSEGSPPPEEPEVTECPRIYGEMDIMSTASQHPAVVGDS
VPEAQHVLSKDDFLKLMLPDSPLVEEGRRKFSFYGNLSPRRSLYRTLSDESVCSNRRGSS
FASSRSSILDQALPNDILFSTTPPYHSTLPPRTHPAPSMGSLRNEFWFSDGSLSDKSKCA
DPGLMPLPDTAAGLDWSHLVDAARAFEGLDSDEELGLLCHHASYLDQRVASFCTLTDLQH
GQELEGAPELSLCVDPTSGKEFMDTPGERSPSTLTGKVNQLELILRQLQTDLRKEKQDKA
VLQAEVQHLRQDNMRLQEESQTATAQLRTFTEWFFSTIDKKV
NT seq 5169 nt   +upstreamnt  +downstreamnt
atgagtgatccaaggccatcacaggcagagaagcacaagcttggcagagctgcctccaaa
ttcaaggacccttccagagccatgcagtctgacgattattttgctcggaaatttaaagcc
atcaatggcagcatggggcctgctactttaaacacgtccagtctgagtgagggcggtgga
ggtggtggtggaccagccaatggtaccccagcagtacccaagatgggtgtgagggccaga
gtgtctgagtggcctcctaaaaaggactgctccaaggacctggcttgcaagacgctgtgg
gagagccgttctcagtccagctatgagagtgccacctccatcatccagaatggccaaaat
gaccaggttgacaggcagcaagaggagcagctagacctggactttgtagaggcaaagtac
accatcggagacatcttcgtgcattctccccagagagggctccaccccatacggcagagg
agcaacagtgatatcaccatcagtgacatcgataccgaggatgtcctggaccaacatgcg
gtcaacccaaacacgggagcagccctgcacagggagtacgggagcacttcatctattgac
aggcagggtctgtctggagagaatgttttcgccatgctccgagggtaccgaatagagagt
tacgaccctaaagtgaccagctcctttgggtttccagatttctttccctgtgacaccgcc
atctcccccagtctccatgctgcagcccagatttccagaggagaattcgtccgcatctca
gggttggactacatggatggtggtctcttgatgggaagggacagagacaagcccttcaaa
cgcaggttaaagtcagagtctgtggaaacctcactcttccgaaaacttcggacagtcaag
agtgagcacgagaccttcaagttcacttctgacctggaggagggccgcctggaccggggc
atccgcccgtggagttgccagaggtgttttgcccattatgatgtgcagagtatcctcttc
aacatcaatgaagccatggccacacgggccagtgtgggcaagagaaagaacatcaccaca
ggggcctcggctgcatcacagactccggttcctgtaggcccggctggaggctgcgagtcc
ccactgggcagcaaggaggacctcaactccaaggagaacccagacgctgatgagggcgat
gggaagagcaacgacctggtcctcagctgcccatattttcgcaacgagaccggtggggag
ggcgacagacgcattgcactctctcgggccaactcagcctctttcagctccggggaaagc
tgctcctttgagtcatccctcagctcacactgtaccaacgcaggtgtctctgtcttggag
gtgccacgggaaaaccagcccatccacagggagaaggtcaaacgttacatcatagagcac
gttgacctcggggcctactactaccgcaagttcttctatggcaaagagcaccagaattac
ttcggaatagatgaaaatctcggccctgtggcggtcagcatccggagggagaaggtggaa
gatcccagggagaaagaagggtcgcagttcaactacagggtggccttcaggacaagtgag
ctcacaactctgagaggagcaatcctagaagacgccgtcccctccacagcccggcatggc
actgcccggggcctgcccctcaaggaagtgctggaatacgttatcccggagttgagtatc
ccgtgtctgcggcaagcagccaactcccccaaagtcccagagcagctgcttaagttggat
gaacaagggctgagcttccagcacaaaatcgggatcctgtactgcaaagccgggcagagc
acggaagaggaaatgtacaacaacgagacagcagggccggccttcgaggagttcctggac
ctcctcggccagcgagtgcggctgaagggcttcagcaagtaccgtgcccagctggacaat
aagacggattccacggggactcactccctctacaccacatataaagacttcgaactcatg
ttccatgtgtcgacactgcttccatatatgccgaacaacaggcagcagcttctgaggaag
aggcacatcgggaacgacatcgtcaccatcatcttccaagagcctggtgctctccctttc
acccccaagaacatccgttcgcacttccagcatgtctttgtcatagtcaaggtgcacaac
ccctgcacagaaaatgtgtgctacagcgttggagtttccaggtcaaaggatgtccctccc
ttcggtcccccaatccccaaaggagtaacttttccaaagtcggccgtcttccgggacttc
cttttagccaaagtaatcaacgcagaaaatgcggcccataagtcagagaaattccgggcc
atggctacccgaacaaggcaagaatacttaaaggatttagccgagaactttgtcacaacc
accacagtggacacttctgcaaaatttagcttcatcaccctgggggcgaagaagaaggag
cgggtaaagcccaggaaggacgcccacctgtttagcatcggggccatcatgtggcacgtg
gtggcgcgggactttggccagtcagcagacattgagtgtcttctggggatctccaatgag
ttcatcatgctgatagagaaggagtccaagaatgtcgtgtttaactgttcctgtagggac
gtgattggctggacatcagggttagtgagcatcaaaatcttctacgaaaggggagagtgc
atcctgctctcctccgtggataactcctcggaagacatccgagaaatagtgcaacgactg
gtaatagtaacgcgaggctgtgagactgtggaaatgaccctgagaaggaatgggttgggt
cagcttggcttccacgtgaactttgaaggaattgttgccgatgtggaaccttttggcttt
gcctggaaggcaggccttcgccaaggaagccggcttgtggagatctgcaaggtggccgtg
gccacactgacccatgagcagatgattgacctactgcggacatctgtgactgtgaaagtg
gttatcatccagccccatgaggatggctctccccgcaggggctgttcagagctctgccgg
atccccatggtggagtacaagctggacagcgagggcacgccctgtgagtacaagacacct
tttaggaggaacaccacatggcaccgagtgcccacccctgccctacagccagtttccaga
gcctcgcctgtgcctggcacaccagaccgactccagtgccagccgctgctgcagcaggcc
caggctgccatcccacgaagtacatcctttgacaggaagctgcccgatggcaccagaagt
tctcccagcaaccagtcatcgtccagcgacccgggacctggtgggagcggaccctggaga
ccacaagtgggctatgatgggtgtccgtcccctctcctgctggagccccagggcccaggc
tctgtggagtgtgatggatccggggatcatgaggacctcatggagggaggcaggcttcca
gaaaccaaatggcatggcccaccttccaaagtcctgagctcctataaggaaagagcgctg
cagaaagacggaagctgcaaagattcccccaataagctgtctcacatcggggataagagc
tgctctagccactccagcagcaacactctctctagtaacacctccagcaacagtgatgac
aagcactttgggtcaggggacctgatggaccccgagctgctgggattgacctacatcaaa
ggcgcttccactgacagcggcatcgacaccacaccgtgcatgccagccaccatcctgggc
ccaatgcatctgacgggcagcaggtccctgatccacagccgggcggaacagtgggcagat
gccgccgatgtctcaggagctgatgaggaccctgccaagatgtataccctgcatggctat
gcctctgccatctccagcagcgctgcagacggtagcatgggtgacctcagtgaggtctct
tctcactccagtggctctcaccgttcaggaagcccctccactcactgctccaaaagcact
gggtctctggacagctccaaagtctacatcgtcactcacagcggtggtcagcaggtacct
ggggctgtggcaaagccttaccacagacaaggagcagcaaacaaatatgtcatcggctgg
aaaaagtcagaaggcagcccaccacctgaggaacctgaagtgactgaatgtcccaggata
tatggcgagatggacatcatgtctacagccagtcagcacccggcagtagtaggagactct
gttccggaagctcagcacgtcctgtccaaagatgactttctgaagttgatgctgcctgac
agccccttagtggaggaggggagacggaagttttcattctacgggaacctgtctccacgg
aggtccctgtaccgaacactgtccgatgagagtgtgtgcagcaaccggaggggctcttcc
ttcgccagctcccgaagctccatcctggaccaggccctgcccaacgacattctcttcagc
acgactccaccctaccacagtacgctgcctccaagaacccaccctgcacccagcatgggg
agcttacggaatgagttctggttctccgatgggtccttatcagacaagtccaagtgtgca
gatcccggcctgatgccgctgccagacacagctgcagggttagactggtcccaccttgtg
gatgctgcacgagcatttgaaggtcttgactcagacgaggaactcgggcttctctgtcac
catgcctcctacctagaccagagggtggcctccttctgcaccctgaccgacctccagcat
ggacaagaactagaaggggccccagagctgtccttgtgtgtagatcccaccagtggcaaa
gaattcatggatacaccaggggagcgatcaccctccacactgactgggaaagttaaccag
ctagaactgattctccgacagctgcagactgacctccggaaggagaagcaggacaaggcg
gtgctgcaggctgaggtccagcacctgaggcaggacaacatgcgactgcaggaagagtca
cagaccgccacagcccagctacgcacgttcaccgagtggttttttagcaccattgacaaa
aaggtctga

DBGET integrated database retrieval system