KEGG   Rattus norvegicus (rat): 361472
Entry
361472            CDS       T01003                                 

Gene name
Mthfd1l, Fthfsdc1
Definition
(RefSeq) methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
  KO
K13402  monofunctional C1-tetrahydrofolate synthase, mitochondrial [EC:6.3.4.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00670  One carbon pool by folate
rno01100  Metabolic pathways
rno01240  Biosynthesis of cofactors
Module
rno_M00141  C1-unit interconversion, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    361472 (Mthfd1l)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     361472 (Mthfd1l)
SSDB
Motif
Pfam: FTHFS THF_DHG_CYH_C THF_DHG_CYH
Other DBs
NCBI-GeneID: 361472
NCBI-ProteinID: NP_001101932
RGD: 1307311
Ensembl: ENSRNOG00000019582
UniProt: B2GUZ3
Position
1p11-q11
AA seq 977 aa
MSARLPLLLRQLGHQQLPPGPACRLRELCRSGSRSSSSGGGDPEGLRGRRLQDGQAFISH
SPGSPEDPGMDSIVRDVIHNSKEVLNLLQEKNPAFKPVLAVIQAGDDHLMQNVNQNLAKE
AGLDITHICLPPDSGEDEIIDEILKINEDPRVHGLALQISEDSLCNKVLNALKPEKDVDG
VTDVNLGKLVRGDAPECFVSPLARAAVELIEKSGITLDGKKVLVIGAHGPLEAALQCLFQ
RKGSMTMSSPWITPQLQDKLREADIVVLGSPKPDEIPAAWIPSGATMLNCFHDFLSGKLR
GGSPGVPMNRLIADESVSLLAAALRVQNMVNSGRRWLREQQHRRWRLHCLKLQPLSPVPS
DIEISRGQTPKAVDVLAKEIGLLADEIEIYGKSKAKVRLSLLERLKDQTDGKYVLVAGIT
PTPLGEGKSTVTIGLVQALTAHLNVNSFACLRQPSQGPTFGVKGGAAGGGYAQVIPMEEF
NLHLTGDIHAITAANNLLAAAIDTRIFHESTQTDKALYNRLVPLVNGVRKFSEIQLSRLK
KLGIHKTDPTALTEEEVRKFTRLNIDPSTITWQRVLDTNDRFLRKITIGQGSTEKGYSRQ
AQFDIAVASEIMAVLALTDSLADMKERLGRMVVASDKDGQPVTAEDLGVTGALTVLMKDA
IKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGME
KFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNL
QKQIQIAQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSAGGKGSVDL
ARAVREAANKRSRFRFLYDVQLPIVAKIRVIAQTVYGAKDIELSPEAQAKIDRYTQQGFG
NLPICMAKTHLSLSHEPDKKGVPRDFILPISDVRASIGAGFIYPLVGMMSTMPGLPTRPC
FYDIDLDTETEQVKGLF
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgagtgcccgccttcctctcctgctacgccaactcggccaccagcagctgcccccgggc
ccggcgtgtcgcctccgtgagctgtgtcgatccggcagcagaagcagcagcagcggaggt
ggtgaccccgaggggttgcgcgggcggcggctgcaggatggccaagccttcatcagccat
agcccaggcagtccggaagaccccgggatggactcaatcgttagagacgtcattcacaat
tccaaagaagtgctgaacttgttgcaagaaaaaaaccctgcctttaagccagttcttgct
gtgattcaggcaggagatgaccacctgatgcagaatgtgaaccagaatttggccaaggag
gctggcctggacatcactcacatctgcctacctccagacagtggagaggatgagatcata
gatgaaatcctgaagattaatgaagaccctagagtgcatggccttgcccttcagatctct
gaagattcattgtgcaacaaagttctcaatgctttgaaaccggaaaaagatgtggacggg
gtgaccgatgtcaatctagggaagctggtgcgaggtgacgctcctgaatgttttgtttcg
cccttggccagagctgcagtagaactcattgagaaatcagggatcaccttggatggaaag
aaggtcttggtcataggggctcacgggcctctggaagctgccctgcaatgtcttttccag
agaaaaggatccatgacaatgagctccccgtggataacacctcagcttcaagacaagctt
cgagaggcagacattgtggtcttgggctcacctaagcccgacgaaattcctgctgcttgg
atcccgtcaggagccaccatgctcaattgcttccatgacttcttgtcagggaagctgaga
ggaggttctcctggggtccccatgaacagactcattgccgacgagagcgtgagtctcctt
gctgcagctctgcgggttcagaacatggtgaacagtggcaggagatggctccgagagcag
cagcatagaagatggcgactccactgcttgaaactgcagcctctctcccctgtgcccagt
gatattgagatctcacgaggacagactccaaaagcggtggatgtccttgccaaggagata
ggattgcttgcagatgaaattgaaatctacggcaagagcaaggccaaagtccgcttgtcc
ctgctggagaggttaaaggatcaaacagatggaaaatacgtcttggttgctgggatcaca
cccaccccacttggagaagggaagagcacagtcaccatcggactagtgcaggcactaact
gctcacctgaacgtcaactccttcgcctgtctgagacagccttcccagggacccactttt
ggagtgaaaggaggagctgcaggtggtggatatgctcaggtcattcccatggaggagttc
aaccttcacctgactggggacatccacgccatcactgccgctaataacttactggctgct
gccatcgacacgagaattttccatgagagcactcagacagacaaggctctatacaatcga
ctggttcccttagtgaatggtgtcagaaaattttcagaaattcaactttctcggctgaag
aaactggggatacataagactgatcccaccgctctgacagaagaggaagtgaggaagttc
acccgcctcaacattgacccctctaccatcacatggcagagagtattggacacgaatgac
cgatttctgagaaaaataactattgggcagggaagcacggagaaaggatattcccggcag
gcacagtttgacattgcagtggccagcgagatcatggccgtgctggccttgactgatagc
ctcgcagacatgaaagagcggctaggaagaatggtggtggccagtgacaaagatgggcag
cctgtgacagctgaggacttgggggtgacaggtgctctgacagttttaatgaaagacgcc
atcaagccaaatctaatgcagaccctggaaggaacacctgtgtttgtgcacgctggtccc
tttgctaatatcgctcatggcaactcgtcggtgttagctgataaaatcgcactaaaactg
gtcggcgaagaagggtttgtagtgactgaagctggctttggggctgatattgggatggag
aaattcttcaacatcaaatgccgagcttctggcctggtgcccaatgttgttgtcctggtg
gccaccgttcgagctctgaagatgcatggaggtgggccaagtgtaaccgctggggttcct
ctcaagaaagaatatacagaagagaacattcagctggtagctgatggctgctgcaaccta
cagaaacaaattcagatcgctcagctcttcggggtgcccgtggtggtggcactgaatgtc
ttcaagacggacacccgtgcagagattgacctggtgtgtgagctcgctaaacgggccggt
gcctttgatgcggtcccctgctatcactggtcagctggaggaaaagggtccgtggacttg
gctcgggctgtgagagaagctgcgaataagagaagccgcttccggttcctgtacgatgtt
cagcttcccatcgtggcaaagataagagtaattgcccagaccgtctatggagccaaggat
attgagctgtctcctgaggcacaggccaaaatcgaccgctatacgcaacagggttttgga
aatttgcccatctgcatggcaaagacccacctttctctgtctcatgaacctgacaaaaag
ggggtgccgagggacttcattctgcccatcagtgatgtccgagccagcatcggggctggg
ttcatttaccctttggtgggaatgatgagcacaatgccaggtctgcccacccgaccctgc
ttttacgatatagaccttgacacagaaacagagcaagttaaaggcttgttctaa

DBGET integrated database retrieval system