KEGG   Rattus norvegicus (rat): 361514Help
Entry
361514            CDS       T01003                                 

Gene name
Meis3, Mrg2
Definition
(RefSeq) Meis homeobox 3
  KO
K16671  homeobox protein Meis3
Organism
rno  Rattus norvegicus (rat)
Brite
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    361514 (Meis3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Motif
Other DBs
NCBI-GeneID: 361514
NCBI-ProteinID: NP_001101942
RGD: 1308532
Ensembl: ENSRNOG00000021390
UniProt: D4A9U2
Position
1q21
AA seq 378 aa AA seqDB search
MARRYEEPRHYPGITEHTAALASFPEAAPSVPRAPGPYGPHRPPQPQGPGLDSDSLKREK
DDIYGHPLFPLLALVFEKCELATCSPRDGASAGLGSPPGGDVCSSDSFNEDIAAFAKQIR
SERPLFSSNPELDNLMVQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIED
RDGGCREDLEDYAASCPSLPDQNTTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQG
DGLDTSVASPSSAGEDEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQ
LAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGASFNPEGQSMAGYTETQPHVTVR
TPGSMGMNLNLEGEWHYL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaggtatgaggagccgcgccactaccccggcattaccgagcacacggcagcc
ctggccagttttccagaggcagcaccttcagtacctcgagctcctgggccctatggccca
caccggccgccccaaccccaaggtccaggcttggacagcgatagcttgaagagagagaag
gatgacatctatggacaccccctcttcccactcttggccctggtctttgagaagtgtgag
ctggctacatgctcgccccgtgatggggcctcggctgggctgggttcacccccaggtggt
gacgtctgctcctctgactccttcaatgaggatattgctgcctttgctaagcagatccgc
tccgagaggccgctgttctcttccaacccggagctggacaacctgatggtccaggccatc
caggtactccggttccacctgctggagctggagaaggtccacgacctgtgcgacaacttc
tgtcaccgctacatcacctgcctcaaggggaagatgcccatagacctggtgatcgaggat
cgggatggtggttgcagggaggaccttgaggactacgcagcctcctgccccagcctccca
gaccagaatactacatggatcagagaccatgaggacagtgggtctgtacatttggggacc
ccaggtccatccagcggaggcctggcctcccagagcggggacaactcaagtgaccaagga
gatgggctggacaccagcgtggcctctcccagctccgcaggagaggatgaggacctggac
ctggagcgcagacggaacaagaagagggggatcttccccaaagtggccaccaacatcatg
agggcctggttgttccagcatctctcgcacccgtacccctcagaagagcaaaagaaacag
ctggcccaggacaccgggctcaccattctgcaggtgaacaactggtttattaatgcccgg
agacggatagtgcagcccatgattgaccagtctaatcgtacagggcagggtgcatctttc
aaccctgagggccagtccatggcaggctacacagagactcaaccacatgtgacagtcagg
acgccaggatcaatggggatgaatctgaacttagaaggagaatggcattacctatag

DBGET integrated database retrieval system