KEGG   Rattus norvegicus (rat): 361517Help
Entry
361517            CDS       T01003                                 

Gene name
Vasp
Definition
(RefSeq) vasodilator-stimulated phosphoprotein
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04510  Focal adhesion
rno04530  Tight junction
rno04611  Platelet activation
rno04666  Fc gamma R-mediated phagocytosis
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    361517 (Vasp)
   04022 cGMP-PKG signaling pathway
    361517 (Vasp)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    361517 (Vasp)
   04530 Tight junction
    361517 (Vasp)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    361517 (Vasp)
   04666 Fc gamma R-mediated phagocytosis
    361517 (Vasp)
   04670 Leukocyte transendothelial migration
    361517 (Vasp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361517 (Vasp)
   04147 Exosome [BR:rno04147]
    361517 (Vasp)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     361517 (Vasp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   361517 (Vasp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH1 VASP_tetra ASD2 Ran_BP1
Motif
Other DBs
NCBI-GeneID: 361517
NCBI-ProteinID: NP_001101945
RGD: 1311542
Ensembl: ENSRNOG00000016367
UniProt: B5DEX4
Position
1q21
AA seq 376 aa AA seqDB search
MSNETVICSSRATVMLYDDSNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKLQPDQQ
VVINCAIIRGVKYNQATPIFHQWRDARQVWGLNFGSKEDAAQFAIGMANALEALEGGGPP
PAPAPPAWSTQNGPSPEELEQQKRQPEHLERRVSNAGGPPAPPAGGPPPPPGPPPPPGPP
PPPGLPPSGVSGAGHGTGVAPPPAPPLPTAQGPSSGGSGAPGLAAAIAGAKLRKVSKEEA
SGGPLAPKAENSRGTGGGLMEEMNAMLARRRKATQVGEKPPKDESASQEESEARIPAQSE
PVRRPWEKNSTTLPRMKSSSSVTTSEAHPSVPSSSDDSDLERVKQELVEEVRKELQKMKE
EIIEVFVQELRKRGSP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgagacggtcatttgttccagccgggctactgtgatgctttacgatgacagc
aacaaacgatggcttcctgctggcaccggtccccaggcctttagccgcgtccagatctac
cacaaccccactgctaactctttccgagttgttggccgcaagctgcagcctgaccagcag
gtggttatcaactgtgccatcattcgaggtgtcaagtacaatcaggccactcccatattc
caccagtggcgtgatgcccgccaggtctggggcctcaacttcggcagcaaggaggacgct
gcgcagtttgcgatcggcatggccaatgccctggaggccttggaaggaggtgggcctccc
cctgccccagcaccccctgcctggtctacccagaatggcccctccccagaggagctggaa
caacagaaaaggcagcctgaacatttggagcgccgggtctccaatgcaggaggcccacct
gctcccccagctgggggcccacctccacctccaggacctccccctcctccgggtcccccc
ccacccccaggtctgcccccctcaggggtatctggggcaggtcatggaacaggtgtagcc
ccaccccctgcacccccactccctacagcacagggccccagtagtgggggttccggggcc
ccaggcctggccgctgccattgctggagccaaactcaggaaagtgagcaaggaggaggcc
tctggggggcccctggcccccaaagctgagaatagtcgaggcactggtggggggcttatg
gaagagatgaacgccatgctggcccggagaaggaaagccacacaggttggggagaagccc
cccaaagacgagtcagccagtcaggaggagtcagaggcccgaatccctgcccaaagtgaa
cctgtgcgaagaccctgggagaagaacagcacaaccttgccaaggatgaagtcatcctct
tctgtgactacctccgaggcccacccctctgtgcccagctccagtgatgactccgacttg
gagagggtgaagcaggagcttgtggaagaggtgcggaaggagctacagaaaatgaaagag
gaaataatcgaagtctttgtccaggagctgaggaagcggggttctccttga

DBGET integrated database retrieval system