KEGG   Rattus norvegicus (rat): 361532
Entry
361532            CDS       T01003                                 

Gene name
Sirt2
Definition
(RefSeq) sirtuin 2
  KO
K11412  NAD+-dependent protein deacetylase sirtuin 2 [EC:2.3.1.286]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00760  Nicotinate and nicotinamide metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    361532 (Sirt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361532 (Sirt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     361532 (Sirt2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     361532 (Sirt2)
SSDB
Motif
Pfam: SIR2 YdjO
Other DBs
NCBI-GeneID: 361532
NCBI-ProteinID: NP_001008369
RGD: 621481
Ensembl: ENSRNOG00000020102
UniProt: Q5RJQ4
Position
1q21
AA seq 350 aa
MDFLRNLFTQTLGLGSQKERLLDELTLEGVTRYMQSERCRRVICLVGAGISTSAGIPDFR
SPSTGLYANLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFIRLLKE
KGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCGKEYTMSWMKEKIFSEA
TPKCEKCQNVVKPDIVFFGENLPPRFFSCMQSDFSKVDLLIIMGTSLQVQPFASLISKAP
LATPRLLINKEKTGQTDPFLGMMMGLGGGMDFDSKKAYRDVAWLGDCDQGCLALADLLGW
KELEDLVRREHANIDAQSGSQASNPSATVSPRKSPPPAKEAARTKEKEEH
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggacttcctacggaatttattcacccagaccctgggcctgggttcccagaaggagcgt
ctgctggacgagctgacccttgaaggagtgacacgctacatgcagagcgagcgctgtcgc
agggtcatctgtttggtgggagctggaatctccacatccgcaggaatccctgacttccgc
tccccatccactggcctctatgcaaacttggagaaataccaccttccatacccagaggcc
atctttgagatcagctacttcaagaaacatccagaacccttctttgcccttgctaaggag
ctctatcctgggcagttcaagccgaccatctgccactacttcatccgcctgctgaaggag
aaggggctgctgctgcgctgctacacgcagaatattgacactctggaacgagtggcaggg
ctggagccccaggacctggtggaggcccacggcaccttctacacatcacactgtgtcaac
acctcctgtggaaaagagtacacgatgagctggatgaaagagaagatcttctcagaagca
actcccaagtgtgagaagtgtcagaatgtggtaaagcccgatatcgtgtttttcggtgag
aacctcccaccgcgcttcttctcctgcatgcagtcagacttctcaaaggtggacctcctc
atcatcatgggcacctccctgcaggtgcagcccttcgcctccctcatcagcaaggcacca
ctagccaccccacgactgctcattaacaaggagaagacaggccagacggatcccttcctg
ggcatgatgatgggcttgggaggcggcatggattttgactccaagaaggcttacagggac
gtggcctggctgggtgactgtgaccaaggctgcctggctctcgctgacctcctgggatgg
aaggagctggaagaccttgtccggagggagcatgccaacatagatgcccagtcagggtca
caggcctccaaccccagcgctaccgtctcccctagaaagtccccacctcctgccaaggag
gcggccaggaccaaagagaaagaggaacactag

DBGET integrated database retrieval system