KEGG   Rattus norvegicus (rat): 361537
Entry
361537            CDS       T01003                                 

Gene name
Tyrobp
Definition
(RefSeq) TYRO protein tyrosine kinase-binding protein precursor
  KO
K07992  TYRO protein tyrosine kinase binding protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04380  Osteoclast differentiation
rno04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    361537 (Tyrobp)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    361537 (Tyrobp)
SSDB
Motif
Pfam: DAP10
Other DBs
NCBI-GeneID: 361537
NCBI-ProteinID: NP_997690
RGD: 1303081
Ensembl: ENSRNOG00000020845
UniProt: Q6X9T7
Position
1
AA seq 114 aa
MGAPEPSWCFLFLPVLLTVGGLSPVQAQSDNYPGCECSSVSPGVLAGIVLGDLVLTLLIA
LAVYSLGRLVSRGRGTADGTRKQHMAETESPYQELQGQRPEVYSDLNTQRQYYR
NT seq 345 nt   +upstreamnt  +downstreamnt
atgggggccccagagccctcctggtgctttctgttccttcctgtcctcctgactgtggga
ggattaagtcccgtacaggcccagagtgacaattacccaggatgcgaatgttcctctgtg
agcccgggtgtactggctgggattgtgctgggcgacttggtgctgactctgctcatcgcc
ctggcggtgtactctctgggccgcctggtctctcgaggccgagggactgcagacgggacc
cggaaacagcacatggctgagactgagtcaccttatcaggagcttcagggtcagaggcca
gaagtatacagtgacctcaacacacagaggcagtattacagatga

DBGET integrated database retrieval system