KEGG   Rattus norvegicus (rat): 361548
Entry
361548            CDS       T01003                                 

Gene name
Dmkn, RGD1561521
Definition
(RefSeq) dermokine
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: KRTDAP
Other DBs
NCBI-GeneID: 361548
NCBI-ProteinID: NP_001166828
RGD: 1561521
Ensembl: ENSRNOG00000055934
UniProt: B2RYK9
Position
1q21
AA seq 516 aa
MKPQGSLACLLLALCLGSGVANPLHSGGEGTGANAAPGMGGTISHGIGESVGQGAKEAAS
SGIQDALGQGHGEGGYALMGGRGDVFDHQLGEAARSLENAGNEIGRRAEDVIRRGVDAAH
NSGSWGTSGGHGVYGSQGGFGSQGNPGVEGTPWASGGNYGTNSLGGSVGQGGSGRPLNYE
TNAQGAVAQPGYGAVRGNNQNSGCTNPPPSDSHESFSDSGGSSNGGSHGGQGNQGSNGQG
NSGGNSGQGSSGSSGNSGNNEGSGGHSGNSGGNSGSGSRDLETSNFDDGYSVSRGTSSSS
GSRGGSGGGGNRPECNNPGNDVRMAGGSGSQESKESSHLLGGSHDYQGHGSGHGSNGGNV
QRDAVSGLNTMNSDASSLPFNLDNFWENFKSKMGFINWDAINKGRGPAPSTRALLYFRRL
WENFKRNTPFFNWKQIEGSDLSSLQKRAGGADQFSQPEAARQDLSAESAKNYYNNAQVNP
TYNWQYYTKTTPKAGVTPSSSASRAQPGLLKWLKFW
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgaagccacaagggtctctggcctgtctcctgctggccctatgtctgggcagcggggta
gctaatccgctgcacagcggaggggagggcacaggggcaaatgctgcccccggaatggga
ggtaccattagccatggaattggagagtctgtgggccaaggggctaaagaagcagccagc
tctggaatccaggatgccctgggtcaggggcacggcgaaggtggctacgcactgatgggg
ggcagaggcgatgttttcgaccaccagcttggggaggcagctcgatctctggagaacgct
gggaatgagattggcagacgggctgaggatgttattcgcagaggggtagacgctgcccac
aactctgggtcctgggggacatctggaggtcatggcgtgtatggctctcaaggtggtttt
ggaagccagggcaatcctggtgttgaagggacaccctgggcctcaggaggcaactatgga
actaactctctgggtggctctgtgggtcagggtggcagtggcaggccgctcaactatgaa
accaatgcccagggggctgtggctcagcctggctatggagcagtgagaggcaacaaccag
aattcagggtgtaccaaccccccaccttctgactcccacgaaagcttcagcgactctggg
ggaagcagcaatggcggcagtcatggtggccaaggcaaccaaggcagcaatggtcagggc
aacagcggcggtaacagcggccaaggcagcagtggcagcagtggcaacagtggcaacaac
gagggcagcggtggccacagtggtaacagcggcggcaacagcggttctgggtcccgggac
ctggaaacgtctaattttgatgatggctattcagtttccaggggaactagctcatcctcc
ggcagcagaggtggtagtggtggtggtggaaacagacccgagtgtaacaacccagggaat
gacgtgcgcatggctggaggatctgggagtcaggaaagtaaagaaagcagccatctcctt
ggaggctcccatgactaccaggggcacgggtccgggcacgggtccaatggtggcaatgta
caaagagatgctgtcagtggactcaacaccatgaactccgatgcatcttccttgcctttc
aacttggacaatttctgggagaattttaaatccaagatgggtttcattaactgggatgcc
ataaacaagggtcgaggcccggctcccagcactcgtgccttactctacttccgcagactg
tgggagaatttcaaacgcaacactcctttcttcaactggaaacagattgagggctcagat
ctgtcatctctgcagaagagggcaggtggtgctgaccagttttctcagccggaagcagca
agacaagatctgtcagctgagtcagccaagaactactacaacaacgcccaggtgaatcct
acttacaactggcaatactataccaagaccacccccaaggcgggagtcacaccttcatcc
tcggcttcccgggcacaacctggcctgctgaagtggctgaagttttggtag

DBGET integrated database retrieval system