KEGG   Rattus norvegicus (rat): 361549Help
Entry
361549            CDS       T01003                                 

Gene name
Lgi4
Definition
(RefSeq) leucine-rich repeat LGI family, member 4
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: EPTP LRR_8 LRR_4 LRR_5 LRRCT LRR_9
Motif
Other DBs
NCBI-GeneID: 361549
NCBI-ProteinID: NP_955793
RGD: 735035
Ensembl: ENSRNOG00000021087
UniProt: Q6P2A4
Position
1q21
AA seq 537 aa AA seqDB search
MGGAGILLFLLAWTGAGVSWSPPKGKCPPRCSCSKESTLCEGSPELPESFSTTLLSLSLV
RMGVSRLKAGSFLKMPSLHLLLFTSNTFSVIEGDAFIGLSYLQYLFIEDNKIGSISKNAL
RGLRSLTHLSLANNHLEALPRFLFQGLETLTHVDLRGNPFQCDCRVLWLLQWMPMVNASV
GTGACAGPSALAQIQLNHLDPKKFKCKATELSWLQTVGESALSVESFSYQGEPHMVLAQP
FAGRCLILVWDYSLQRFRSEEELSAPSVVSCKPLVLGPRLFILAARLWGGSQLWSRSSPD
LRLTPVQVLAPQRLLRPNDAELLWLDGQPCFVVADASKAGSTTLLCRDGPGFYPRQSLHA
WHRDTDAEALELDGRPHLLLASASQRPVLFHWFGGRFERRTDIPEAEDVYATKHFQAGGD
VFLCLTRYIGDSMVMRWDGSMFRLLQQLPSRGSHVFQPLLIASDQLAILGSDFAFSQVFR
FEPDKGILEPLQELGPPALVAPRAFGQVTVAGRRFLFAACFKGPTQIYQHHELDLSA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggaggggcaggcattctgttgttcctgttggcctggactggggcaggagtgtcctgg
agtccccccaagggaaagtgtcctccacgctgctcctgctccaaggagagcaccctgtgt
gagggctcccccgagctgcctgagagcttctccaccacgctcctgtcactctctctcgtc
aggatgggggtctcccggctgaaggctggaagctttttaaagatgccgtcactgcacttg
ctcctcttcacgtccaataccttctctgtaattgagggtgatgccttcatcggcctgtcc
tacctgcagtacctcttcattgaggacaacaagatcggctccatctctaagaacgccctg
aggggactccgctcactgacccacctaagcctggccaacaaccaccttgaggctctaccc
agattcctgttccaaggcttggagactctgactcatgtggacctccgtggtaacccgttc
cagtgtgactgccgagtactttggttgctacagtggatgcctatggtgaatgccagtgtg
ggcacgggggcctgtgcgggcccctctgcacttgctcaaatacaactgaatcacctcgac
cctaagaagttcaagtgtaaagccacagaactctcctggctccagactgttggggagtcg
gcactgagcgtggagtccttctcctatcagggggaacctcacatggtcctggcacagccc
ttcgctggccgttgcctgatcctggtgtgggactacagcctgcagcgcttcaggtctgag
gaagagctgtccgcgccctcagtggtgtcctgcaaacctctggtgctgggcccacgcctc
ttcatactggctgctcgcctatggggaggctcacagctgtggtcacggtccagccccgac
ctgcgtctgacccctgtgcaagtcctagcccctcaacggctgctgcgacccaatgatgcc
gagctcctgtggctggatgggcagccctgcttcgtggtggctgatgcttccaaggctggc
agcaccacgctgctgtgtcgtgatgggccgggcttctacccacgccagagcctgcacgcc
tggcaccgcgacaccgatgcagaggccctggagctggacggccgaccgcacctgttgctt
gcttccgcctcccagaggcctgtgctctttcactggtttggtggccgattcgagaggcgc
acagacatcccagaggcagaggacgtctatgccacaaaacactttcaggcgggaggagac
gtgttcctgtgcctgactcgatacattggggactccatggtcatgcgctgggacggctcc
atgttccgtctgctgcagcaacttccatctcgaggctcccatgtcttccagccactacta
attgccagcgaccagttggccattctgggcagcgacttcgccttcagccaagtcttccgc
tttgagcccgataaagggatcctggagccactacaggagctgggcccaccggccttggtg
gccccccgagcctttggccaagtcactgtagcaggaagacgctttttattcgcagcgtgc
ttcaaggggcccacgcagatctaccagcaccatgagttggatctcagtgcctga

DBGET integrated database retrieval system