KEGG   Rattus norvegicus (rat): 361568Help
Entry
361568            CDS       T01003                                 

Gene name
Rras, p23
Definition
(RefSeq) related RAS viral (r-ras) oncogene homolog
  KO
K07829  Ras-related protein R-Ras
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04072  Phospholipase D signaling pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno04218  Cellular senescence
rno04360  Axon guidance
rno04371  Apelin signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    361568 (Rras)
   04015 Rap1 signaling pathway
    361568 (Rras)
   04010 MAPK signaling pathway
    361568 (Rras)
   04371 Apelin signaling pathway
    361568 (Rras)
   04072 Phospholipase D signaling pathway
    361568 (Rras)
   04024 cAMP signaling pathway
    361568 (Rras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    361568 (Rras)
   04137 Mitophagy - animal
    361568 (Rras)
  09143 Cell growth and death
   04218 Cellular senescence
    361568 (Rras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    361568 (Rras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    361568 (Rras)
  09158 Development
   04360 Axon guidance
    361568 (Rras)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    361568 (Rras)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    361568 (Rras)
GTP-binding proteins [BR:rno04031]
 Small (Monomeric) G-proteins
  Ras Family
   Ras [OT]
    361568 (Rras)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1 AAA_22
Motif
Other DBs
NCBI-GeneID: 361568
NCBI-ProteinID: NP_001101951
RGD: 1311443
Ensembl: ENSRNOG00000037247
UniProt: D3Z8L7
Position
1q22
AA seq 218 aa AA seqDB search
MSSGAASGTGRGRPRGGGPGPRDPPPGETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGNGFLLVFAINDRQSFIEVS
KLFTQILRVKDRDDFPIVLVGNKADLETQRQVLRSEASSFSASHHMTYFEASAKLRLNVD
EAFEQLVRTVRKYQEQELPPSPPSAPRKKDGRCPCVLL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggggcggcgtccgggactgggcgggggcggccccggggcggggggccggga
cccagggaccccccgcccggcgagactcacaagctggtggtcgtaggcggcggcggcgtg
ggcaagagcgcgctgaccatccagttcatccagtcctactttgtgtctgactatgacccc
accattgaggattcctacacaaagatctgcacggtggacggcatccctgcacggctggac
atcctggacactgcggggcaagaggaattcggcgccatgcgggagcagtacatgcgtgct
ggcaatggcttcttgctggtgtttgccattaacgacaggcagagtttcattgaagtaagc
aagctcttcactcagatcctcagggtcaaggaccgcgatgacttccccattgtgctggtt
gggaacaaggcagatctggagacacagcgccaggtccttcgatcagaggcctcctccttt
agtgcttcccaccatatgacttactttgaggcctcagccaaactgcgtctaaatgtcgat
gaggcatttgagcagctggtgcggactgtccggaaataccaggagcaagaactccctcct
agcccacccagtgcccctaggaagaaggatgggaggtgcccctgtgtcctgctgtag

DBGET integrated database retrieval system