KEGG   Rattus norvegicus (rat): 361574Help
Entry
361574            CDS       T01003                                 

Gene name
Snrnp70, Snrp70
Definition
(RefSeq) small nuclear ribonucleoprotein U1 subunit 70
  KO
K11093  U1 small nuclear ribonucleoprotein 70kDa
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    361574 (Snrnp70)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    361574 (Snrnp70)
Spliceosome [BR:rno03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    361574 (Snrnp70)
 Complex B
    361574 (Snrnp70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U1snRNP70_N RRM_1 RRM_7 GGN
Motif
Other DBs
NCBI-GeneID: 361574
NCBI-ProteinID: NP_001101953
RGD: 1307120
Ensembl: ENSRNOG00000020763
UniProt: D3Z8H0
Position
1q22
AA seq 166 aa AA seqDB search
MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA
ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLR
REFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSTTQLACS
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacacagtttctgcctcccaaccttctggccctttttgcaccccgagaccccatccca
tacctgccacccctggaaaagctgccacatgaaaaacaccataaccaaccttactgtggc
attgcaccatatatccgagagtttgaggaccctcgagatgcccctcctccaacaagggca
gaaacccgggaagaacgcatggagagaaagagacgggaaaaaattgaacggcgacagcag
gaagtggagacagagctgaaaatgtgggaccctcacaatgatcccaatgctcagggcgat
gccttcaagactctgttcgtggctagagtgaactatgacacaacagaatctaagctgcga
agagagtttgaggtgtacggacccatcaaaagaatccacatggtctacagtaaacgctct
gggaaaccccgtggttatgccttcatcgagtatgagcatgaacgagacatgcactccacc
acgcagctggcttgcagctga

DBGET integrated database retrieval system