KEGG   Rattus norvegicus (rat): 361586Help
Entry
361586            CDS       T01003                                 

Gene name
Trpm1
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 1
  KO
K04976  transient receptor potential cation channel subfamily M member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    361586 (Trpm1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   361586 (Trpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSDAT_euk TRPM_tetra Ion_trans LSDAT_prok DUF3482 XhlA
Motif
Other DBs
NCBI-GeneID: 361586
NCBI-ProteinID: NP_001032823
RGD: 1597140
Ensembl: ENSRNOG00000015829
UniProt: Q2WEA5
Position
1q22
AA seq 1628 aa AA seqDB search
MGSMRKMSSSFKRGSIKSSTSGSQKGQKAWIEKTFCKRECIFVIPSTKDPNRCCCGQLTN
QHIPPLPSVTPSSTAEDTKQGDAQSGKWSVSKHTQSYPTDSYGILEFQGGGYSNKAMYIR
VSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQSFEMQPKLKQVFGKGLIKAAMTTGAW
IFTGGVSTGVVSHVGDALKDHSSKSRGRLCAIGIAPWGMVENKEDLVGKDVTRVYQTMSN
PLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRQLEKHISLQKINTRLGQGVPVVGLVV
EGGPNVVSIVLEYLREDPPVPVVVCDGSGRASDILSFAHKYCDEGGVINESLRDQLLVTI
QKTFNYSKSQSHQLFAIIMECMKKKELVTVFRMGSEGQQDVEMAILTALLKGTNVSAPDQ
LSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPVDTKVAEKEKKPPTATTKGRGKGKGKK
KGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPR
LEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKSFR
TLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHEL
MVWAVLMKRQKMAVFLWQRGEECMAKALVACKLYKAMAHESSESELVDDISQDLDNNSKD
FGQLAVELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTD
MWMGRLRMRKNPGLKVIMGILIPPTILFLEFRSYDDFSYQTSKENEDGKEKEEENVDANA
DAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDG
WPSPQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISMFMVGAI
LRLQNQPYMGYGRVIYCVDIILWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLV
VLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDRKTRIHIYAMEINPP
CGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQV
WKFQRYQLIMTFHDRPVLPPPMIILSHIYIIVMRLSGRCRKKREGDQEERDRGLKLFLSD
EELKKLHEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEINERENFMKAS
LQTVDLRLSQLEELSGRMVGALENLAGIDRSDLIQARSRASSECEATYLLRQSSINSADG
YSMYRYHFNGEELLFEEPALSTSPGTVFRKKTCSFRVKEEDVKPHLDQPSSLHHTPGPSP
PATPGRSRLALDGPLSTELRPGLDPGISAGELDPRADFKSAEVAPSLNTANVASTQLTVE
STVSHPLRESKLARYYPGDLNTYKTMKSRSFVYSEGRKLVRGLSNWGAEYSSIMDQTWNS
AEWRCQVQRITRSRSTDIPYIVSEAASQDEFEDEHRESLLAPQISRSALTVSDRPEKENL
LSVKPHQTLGFPCLRSRSLHGHPRSAKPSPSKLDRAGHASSTSNLAVMSDAPEGQNTQQE
KGNPETEC
NT seq 4887 nt NT seq  +upstreamnt  +downstreamnt
atggggtccatgaggaaaatgagcagctccttcaagcgtggttcaatcaagagctccaca
tcagggtcccagaagggtcagaaagcatggatagagaagacgttttgcaaaagggaatgc
atcttcgtgattcctagtacaaaagacccgaacagatgttgctgtggtcagctcactaac
cagcacatccccccgctgccgagtgtgactcccagctcaacagcagaggacaccaagcaa
ggggacgcacagtccgggaaatggtctgtcagcaaacacacccagagctacccaacagac
tcctatgggattcttgaattccagggtgggggctactccaataaagccatgtatatccga
gtctcctacgacaccaagccagattctctgctccatctcatggtgaaggactggcagctg
gagctccccaagctcttgatatctgtgcatggaggcctccagagctttgagatgcagccc
aagctgaagcaggtctttgggaaaggtctgatcaaggctgccatgaccacaggggcatgg
atcttcaccgggggagtgagcactggtgtcgtcagccatgtgggggatgccttgaaggac
cactcctccaagtccagaggccggctctgtgctatcggaatcgctccctggggcatggtg
gagaacaaggaagatctggttgggaaagatgtaacgagagtctaccagaccatgtccaac
cctctgagcaagctctccgtgctcaacaattctcacactcacttcatcttggctgacaat
ggcacccttggcaagtatggtgccgaggtgaagcttcgaagacaactggaaaaacacatc
tccctgcagaagatcaacacgaggctgggccagggtgtacctgtcgtgggtctcgtggtg
gaaggtggacctaatgtggtttctatcgtcctggagtatctcagagaagaccctcctgtc
cctgtggtggtttgtgacggcagtggacgcgcctccgacattttgtcttttgcacacaaa
tactgcgacgaaggaggggtcataaacgagtccctgcgggaccagcttctagttaccatt
cagaaaacatttaattacagcaagtcccagtcgcatcagctgtttgcaattatcatggag
tgcatgaagaagaaagaactcgtcactgtgtttcggatgggctctgagggtcagcaagat
gttgagatggcaattttaactgccttgctcaaaggaaccaacgtgtcagctccagatcag
ctgagcttggcactggcttggaaccgcgtggacatagcacgaagccagatcttcgtcttt
ggcccacactggccgccactgggaagcctggcccctcctgtggacaccaaagtcgcagag
aaggagaagaagccacccacagccaccaccaagggaagaggaaaagggaaaggcaagaag
aaaggcaaagtgaaagaggaggtggaggaagaaacagacccccggaagatcgagctgctg
aactgggtgaacgccctggagcaagccatgctggacgctcttgtcttagaccgggttgac
tttgtgaagctcctgattgaaaacggagtgaacatgcagcatttcctcactatcccgagg
ctggaggagctttacaacactagactgggcccaccaaacacccttcatctgctggtgcgg
gatgtgaagaagagcaaccttccacctgactaccacatcagcctcatcgatataggactg
gtgttggagtacctcatgggaggtgcctaccgctgcaactacactcggaaaagcttccgg
actctctacaacaacttgtttggccctaagaggccaaaagcacttaaactcctgggaatg
gaagatgatgagcccccagccaaggggaagaagaaaaagaagaagaagaaagaggaggag
attgatatagatgtggacgaccccgctgtgagtcggttccagtatccgttccacgagctc
atggtatgggccgtgctcatgaagcgccagaagatggcagtcttcctgtggcagcgtggg
gaggagtgcatggcaaaggccttggtggcctgtaagctctacaaggccatggcccacgag
tcctcggagagcgagctggtggatgacatctcccaggatctggacaacaattccaaggat
tttggccagctcgctgtggagctgttagaccagtcttacaagcacgatgagcaagtggcc
atgaaacttctgacctatgagctcaagaactggagcaactcgacctgccttaagctggcc
gtggcggccaagcacagggactttatcgctcacacctgcagccagatgctgctgacagac
atgtggatgggaaggcttcgcatgaggaagaaccctggcctgaaggtcatcatggggatc
cttatcccgcccaccatcttgtttttggaattccgttcatatgatgacttctcctatcaa
acatccaaggagaatgaagatggcaaagaaaaggaagaagagaatgtggatgcaaatgca
gatgctggctcaagaaagggggatgaggagaatgagcacaaaaaacagaggagcattccc
attggaacaaagatctgtgaattctataatgcgcccattgtcaagttctggttttacaca
atctcctacttgggctacttgctgctgttcaattatgtcatcctggtgcggatggacggc
tggccttcaccccaagaatggatcgttatctcctacattgtgagcctggcactagagaaa
atacgagagatcctcatgtcggaaccaggcaaactcagccagaaaatcaaagtgtggctc
caagagtactggaacatcacagaccttgtggccatttccatgttcatggttggggccatc
cttcgcctccagaaccagccatacatgggctatggccgggtcatctactgtgtggatatc
atcctctggtacatccgagtgttagacatctttggtgtcaacaagtatcttggcccctat
gtaatgatgattggaaagatgatgattgacatgctgtactttgtggtcattatgctggtt
gtgctgatgagtttcggcgtagctcggcaagccatcttgcacccagaggagaagccttct
tggaaactggcccgaaacatcttctacatgccctactggatgatctacggagaagtgttt
gcagaccagatagaccgtaagactagaattcatatctatgccatggaaatcaaccctcct
tgtggtgaaaatctctatgatgaggaaggcaagaggctccctccctgcatccctggtgcc
tggctcacacctgccctcatggcctgttatctcctggtggccaatatcctgctggtcaac
ctgctgattgctgttttcaacaataccttctttgaagtcaagtcaatatccaatcaagtg
tggaagttccagcggtaccaactgatcatgacatttcacgacaggccggtcctgcccccg
ccaatgatcatcttaagccacatctacatcatcgttatgcgtctcagtggtcgctgcaga
aaaaagagagaaggggaccaggaggagcgggatcgtgggttgaagctgttcctcagcgac
gaggaactgaaaaaactgcatgagtttgaggagcagtgcgtgcaggagcacttccgagaa
aaggaggatgagcagcagtcgtccagcgatgagcgcatccgggttacaagcgagagagtt
gaaaatatgtcaatgaggctggaggaaatcaacgaaagagaaaatttcatgaaggcgtct
ctgcagactgtcgaccttcggctctctcagctggaggagctatctggcaggatggtgggc
gctctggagaatctggcaggcatcgacaggtctgatctgatccaggctcgatcaagagca
tcctcagaatgtgaggccacctacctgctgcggcagagcagtatcaacagcgccgatggc
tacagcatgtaccgctaccatttcaatggcgaggagcttctgtttgaggagcccgccctc
tccacttcgccagggacagtgttccggaaaaaaacctgctccttccgcgtgaaggaagag
gatgtaaaaccacacctggaccagccaagtagcctgcaccacaccccaggccccagcccg
cctgccacgccaggtcgcagccggcttgcccttgatggtcccttgagcacagagttgaga
cctggactggatcctggtatctctgcgggtgagcttgatccgcgggcagatttcaagagc
gccgaagttgcaccaagtctgaacacggcgaatgttgcaagcactcagctgaccgtcgaa
agcactgtttcccacccactgcgggagagcaaactcgcgcgctactaccccggagacctc
aacacctacaaaacaatgaagtccagaagcttcgtctattctgaaggaagaaaacttgtc
cgaggtcttagcaactggggtgccgagtacagttcaatcatggaccaaacatggaactcg
gcagaatggagatgtcaagttcaaaggatcacacgctcccgcagcacagacatcccgtac
attgtgtctgaagcagcctcccaagatgagtttgaggatgagcacagagaatctcttctg
gctcctcagatctcccgttcagccctcacggtctctgacaggcccgaaaaggaaaacttg
ctgtctgtgaagccacaccagactttaggattcccctgcctacggtcaagaagtttacat
ggtcatcctaggagtgccaaaccctctcctagcaaattagacagggcgggacatgccagc
agcaccagcaacttagcagttatgtcagacgctccagagggacaaaacacccagcaggag
aaaggaaacccggaaactgaatgctaa

DBGET integrated database retrieval system