KEGG   Rattus norvegicus (rat): 361588Help
Entry
361588            CDS       T01003                                 

Gene name
Lrrc28
Definition
(RefSeq) leucine rich repeat containing 28
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_9
Motif
Other DBs
NCBI-GeneID: 361588
NCBI-ProteinID: NP_001101956
RGD: 1307209
Ensembl: ENSRNOG00000023274
UniProt: D4A4Y4
Position
1q22
AA seq 367 aa AA seqDB search
MASELCKTISVARLEKHKNLFLNYRNLHHFPLELLKDEGLQHLERLYMKRNSLTTLPENL
AQKLPNLVELYLHSNNIVVVPEAIGSLVKLQCLDLSDNALEIVCPEIGRLRALRHLRLAN
NQLQFLPPEVGDLKELQTLDISTNRLLALPERLHLCLSLQYLTVDRNRLWCVPRHLCQLP
SLNELSMAGNRLASLPVDLGRSRELQYVYVDNNVNLKGLPSYLYNKVIGCNGCGIPIQLS
EVRLLTFSSGELTVFLPAEVKAIGTEKDHVLPLQELTMRSLHRTYHGLWKDLNFLSPISL
PKSLLELLHCPLGHCHRCSEPMFTFVYPKLFPLRETPMAGLHQRRTSIGFVAYCCSAQCL
RTFNLLC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgaactctgtaagacgatctctgtggccaggcttgaaaagcacaagaatttg
ttcttaaattacaggaacctgcaccattttccactggagttactgaaagatgaggggctg
cagcacctggagaggctctacatgaaaaggaactccctcacaaccttgccagaaaacctt
gctcagaagcttccaaaccttgtggaactgtaccttcactcgaataacatagttgtggtt
ccagaagccatcgggtcccttgtgaaactccagtgtctggatctcagtgacaatgcctta
gagatcgtttgcccagagattggtcgtctgagagcgttacgtcatcttcgattggctaat
aaccagctacaattcctacctccagaggttggcgatttgaaggagctgcagacactagac
atttctaccaaccgtttgctagctttacccgagaggcttcacctgtgcctttctctgcag
tacctcactgtggaccgcaatcggctctggtgtgtgccgcgtcatctctgccagctgccc
agcctcaatgagctctccatggctggaaaccgtcttgcatctttgccagttgacttaggt
cgctctcgagaactgcagtatgtgtatgtggataacaacgtcaacctgaaaggcctgccc
tcatacctctacaacaaagtcatcggctgcaacggctgtggcatccccatccagttgtca
gaggtgagactgctgaccttctcatctggggagctgaccgtgttcctcccagcagaggtg
aaggcaataggcacagagaaggatcacgtcctaccgctgcaagagctgaccatgcgcagt
ctccaccgcacctaccatgggctttggaaagatctgaactttttgtctccaatctcatta
cccaaaagtctcctggagctgctgcactgccccctggggcactgtcaccggtgtagtgag
cccatgtttacctttgtctaccctaagctcttccccttgagagagacgccaatggcaggc
ctgcaccagaggaggacaagtattggcttcgtggcctactgctgctccgcccagtgtctg
cggacttttaacctgctgtgttga

DBGET integrated database retrieval system