KEGG   Rattus norvegicus (rat): 361598Help
Entry
361598            CDS       T01003                                 

Gene name
Iqgap1
Definition
(RefSeq) IQ motif containing GTPase activating protein 1
  KO
K16848  Ras GTPase-activating-like protein IQGAP1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04520  Adherens junction
rno04810  Regulation of actin cytoskeleton
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    361598 (Iqgap1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    361598 (Iqgap1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    361598 (Iqgap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361598 (Iqgap1)
   04147 Exosome [BR:rno04147]
    361598 (Iqgap1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     361598 (Iqgap1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   361598 (Iqgap1)
  Exosomal proteins of breast milk
   361598 (Iqgap1)
  Exosomal proteins of other body fluids (saliva and urine)
   361598 (Iqgap1)
  Exosomal proteins of colorectal cancer cells
   361598 (Iqgap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGAP RasGAP_C CH IQ bZIP_1 CAMSAP_CH WW
Motif
Other DBs
NCBI-GeneID: 361598
NCBI-ProteinID: NP_001101959
RGD: 1311884
Ensembl: ENSRNOG00000012002
UniProt: G3V7Q7
Position
1q31
AA seq 1657 aa AA seqDB search
MSAAEEVDGLGVVRPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKIELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDHRVAADTFTAL
KNPNAMLVNLEEALAPTYQDVLYQAKQDKMTNAKNRTENSDRERDVYEELLTQAEIQGNV
NKVNTSSALANINLALEQGCALTLLKALQSVALGLRGLQTQNSDWYLKQLQSDLQQKRQS
GQTDPLQKEEVQAGVDAANGAAQQYQRRLAAVAAINAAIQKGIAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQQQSPEHSLTHPELTVAVEMLSSVALINRALESGDMNTVWKQLS
SSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFVTWNDIQACVDHVNLVVHEEHERIL
AIGLINEALDEGDAQKTLQALQIPAAKLEGVLPEVAQHYQDTLIRAKREKAQETQDESAV
LWLDEIQGGIWQSNKDTQEAQRFALGIFAINEAVESGDVGRTLSALRSPDVGLYGVIPEC
GETYQSDLAEAKKKRLAAGDNNSKWVKHWVKGGYHYYHNLETQAGGWAEPPDFVQNSVQL
SREEIQSSISGVTAAYNREQLWLANEGLITKLQACCRGYLVRQEFRSRMNFLKKQIPAIT
CIQSQWRGYKQKKAYQDRLAYLHSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII
KIQAFIRANKARDDYKTLINAEDPPMIVVRKFVHLLDQSDQDFQEELDLMKMREEVITLI
RSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKA
LSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEY
LLLRLFQTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIM
DDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALSHEEVKTRLDNSIRNMRA
VTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAAEDELLKIIGNLLYYRYMNPAI
VAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ
KFRRFFQAACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEH
NDPIHELLDDLGEVPTIESLIGESCGNSNDPSKEALAKTEVSLTLTNKFDVPGDENAEMD
ARTILLNTKRLIVDVIRFQPGETLTEILETPATNEQEAEHQRAMQRRAIRDAKTPDKMKK
SKPMKEDNNLSLQEKKEKIQTGLKKLTELGTVDPKNRYQELINDIAKDIRNQRRYRQRRK
AELVKLQQTYSALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKIS
LKYTAARLHEKGVLLEIEDLQANQFKNVIFEIGPTEEVGDFEVKAKFMGVQMETFMLHYQ
DLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcggaggaggtcgatggcctgggtgtggtccggccgcactatggctctgtc
ctggataatgagagactcacggcagaggagatggatgagaggaggcgacagaacgtggcc
tatgagtacctttgtcatttggaagaagcaaagaggtggatggaagcatgcctaggggag
gacctgccgcccaccacagagctggaggagggccttcggaatggggtctaccttgccaag
ctagggaacttcttctcccccaaagtggtgtccctgaagaaaatctacgatcgagagcag
accagatacaaggctaccggcctacacttcagacacacggataatgtgattcagtggctg
aatgccatggatgagattggattgcctaagattttttatccagaaaccacagatatctac
gaccggaagaacatgccaagatgtatctactgtatccacgccctcagtttgtacctgttc
aaactgggcctggctcctcagattcaagacctgtatggaaaggttgacttcacagaggaa
gaaatcaacaacatgaagattgagcttgagaagtacgggatccagatgcctgccttcagc
aagatagggggcatcctggctaacgagctctcggtggatgaggctgcattacacgctgct
gtcattgctattaatgaagctattgatcacagagttgcagctgacacgtttacggctctg
aaaaaccccaatgccatgcttgtcaatcttgaagaagcgctggctcccacctaccaggat
gtgctttaccaggccaagcaggacaagatgacaaatgctaaaaacaggacggaaaactct
gacagagaaagggacgtttatgaggaactgctcacacaagctgaaatccaagggaatgta
aacaaagtcaacacatcatctgccctggccaacatcaacctggctttagagcagggctgt
gcactgaccctgctcaaggctctgcagtcagtggctctgggcctccgagggttgcagacc
cagaacagcgactggtacctgaagcagctacagagtgatctgcagcaaaaacgacagagt
ggccagactgaccctctgcagaaggaggaggtacaggccggagtggatgctgccaacggt
gctgcccaacaataccaacgacggttggcagcagtggcagcgatcaatgcggcgatccag
aagggcatcgccgagaagaccgttttggagctaatgaatcctgaagcccagctgccccag
gtgtatccatttgcagccgatctttatcagaaggagttggccaccctgcagcagcagagt
cctgagcatagcctcacccatcctgaactcactgttgccgtggagatgctgtcttctgtg
gccctcatcaacagggcgctggagtcaggagacatgaacacggtgtggaagcagctgagc
agctccgttacaggccttaccaatatcgaggaagaaaactgtcaaaggtatctggatgag
ctgatgaagctgaaggcgcaggcacatgcagagaataatgaatttgtcacgtggaatgac
atccaggcgtgtgtggaccacgtgaacctggtggtccacgaggaacatgagcggattttg
gccattggtttaattaatgaagccctggatgaaggggacgctcagaagactctgcaggcc
ctgcagatccctgcagccaagctcgagggggtccttccagaggtggcacagcattatcaa
gacacgctgatcagagcaaagagagaaaaggcccaggaaacccaggatgagtcagctgtg
ttatggttggatgaaattcaaggtggaatctggcagtccaacaaagacacccaggaagca
cagaggtttgccctaggaatcttcgccatcaacgaagcagtagagagtggtgatgttggc
agaaccctgagtgcccttcgttctccggacgttggcttatatggagtgatccctgagtgt
ggggaaacataccagagtgaccttgctgaagccaagaagaaaagactagcagcaggagac
aataacagcaagtgggtgaagcactgggtgaaaggcgggtaccattactaccacaatctg
gagacgcaagcaggaggatgggctgaacccccagacttcgtgcagaattctgtgcagctt
tctcgagaggaaatccagagctccatctctggagtgaccgctgcgtataaccgagagcag
ctttggctggccaacgaaggcttgattaccaagctgcaagcctgctgccgtgggtacctt
gttcgacaggaattccgatcccggatgaactttctgaagaaacagatccccgccatcacc
tgcattcagtcacagtggagaggatacaaacagaagaaggcatatcaagatcggctggct
tacctgcactcccataaagacgaagttgtgaagattcagtcccttgccaggatgcatcaa
gccagaaagcgctatagagatcgcctacagtatttccgagaccacataaatgacattatc
aaaatccaggctttcattcgggcaaacaaagctcgcgatgactacaagactctcatcaat
gctgaggatccgcctatgattgtggtccgaaagtttgtccacctcctggaccaaagtgat
caggactttcaggaagagcttgatcttatgaagatgcgggaggaggtcatcaccctcatc
cgttccaaccagcagctggagaatgacctcaatctcatggatatcaaaatcggcctgctg
gtaaagaacaagatcaccctgcaggatgtggtttcccatagtaaaaaacttaccaaaaag
aataaggagcagttgtctgacatgatgatgataaacaagcagaagggcgggctcaaggcc
ctgagcaaggagaagagggagaagctggaagcctatcagcatctcttctatctgctacag
accaaccctacctatctggccaagctgatttttcagatgccacagaacaagtccaccaag
ttcatggactctgtgatcttcacgctctacaactatgcatccaaccagcgggaggagtac
ctgctgctccgactcttccagacggcactgcaggaggagatcaagtcaaaggtggatcag
attcaagaaatcgtgacaggaaaccctacagttattaagatggttgtaagcttcaaccgt
ggtgcccggggccagaatgccctccggcagatcttggctcctgttgtgaaggaaattatg
gatgacaagtctctcaacatcaaaaccgaccccgtggacatttacaagtcttgggttaat
cagatggagtctcagacaggagaagcgagcaaactgccttatgatgtgacccctgagcaa
gccttgtctcatgaagaagtgaagacgaggttagacaactccatcaggaacatgagggct
gtgacagacaagttcctttcagccatcgtcagctctgtggacaaaatcccttacgggatg
cgcttcattgccaaagtgctgaaggactctttgcacgagaagttcccggatgctgccgag
gacgagctgctgaagattattggtaacctgctttactaccgatacatgaacccggccatc
gttgctcctgatgccttcgacattattgacctgtcagcaggaggccagctcaccacagac
cagcgtagaaatctgggctccattgcaaagatgctgcagcacgcggcttccaacaagatg
tttctgggtgataatgctcacctaagcatcattaatgaatatctctctcagtcctaccag
aaattcagacggtttttccaagccgcttgcgacgtcccagagctacaggataagtttaat
gtggatgagtattccgatctagtcaccctcaccaagccggttatctacatttccattggt
gagatcatcaacacccacactctcctgttggaccatcaggacgccattgctccagagcat
aacgaccccatccatgaactgctggatgaccttggagaggtgcccaccattgagtccctt
ataggagaaagctgtggtaattcaaatgaccccagcaaggaggcgctggctaagactgaa
gtgtctctcacactgaccaacaagtttgacgtgcctggtgatgagaacgcagagatggat
gcgcggaccatcttactgaatacaaaacgtttaattgtggatgtcatccggttccagcca
ggagagaccttgactgaaatcctagaaaccccagccaccaatgaacaggaagctgaacat
cagagggccatgcagagacgggctatccgcgatgccaaaacccctgacaagatgaaaaaa
tcaaagcccatgaaggaggataacaacctcagcctccaggagaagaaagagaagatccag
actggcctaaagaagctaacggaacttgggacggtggacccaaagaacagataccaggaa
ctcatcaacgacattgctaaggatatccggaatcagcggcgatacaggcagaggaggaag
gctgagctggtaaagctgcagcagacctactcggcgctgaactcgaaggccaccttttac
ggagagcaggtggattactacaagagctacatcaagacctgcttggataacttggccagc
aagggcaaggtctccaaaaaacctagggaaatgaaaggcaaaaaaagcaaaaagatttct
ctgaagtacacagcagcaagactgcatgagaagggagtgcttctggaaattgaggacctt
caagcaaaccaatttaaaaatgttatcttcgaaattggtccaacagaagaagttggagac
tttgaagtgaaggccaagttcatgggcgttcagatggagactttcatgctgcattatcag
gacttgctgcagctacagtatgaaggggttgcggtcatgaagttgtttgatagagctaaa
gtgaatgtcaacctcctgatcttccttctcaacaaaaagttctatgggaagtaa

DBGET integrated database retrieval system