KEGG   Rattus norvegicus (rat): 361630Help
Entry
361630            CDS       T01003                                 

Gene name
Tead1, TEF-1
Definition
(RefSeq) TEA domain transcription factor 1
  KO
K09448  transcriptional enhancer factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    361630 (Tead1)
   04392 Hippo signaling pathway - multiple species
    361630 (Tead1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361630 (Tead1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   TEA domain
    361630 (Tead1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: YBD TEA
Motif
Other DBs
NCBI-GeneID: 361630
NCBI-ProteinID: NP_001185518
RGD: 1549742
Ensembl: ENSRNOG00000015488
UniProt: F1M7P3 Q6QQU2
Position
1q33
AA seq 415 aa AA seqDB search
MERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIAR
YIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKVTSMDQTAKDKALQHMAAMSSAQIV
SATAIHNKLGLPGIPRPTFPGGPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIP
GFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYSD
PLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQDDAGAFYGVSSQ
YESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCEYMINFIHKLKH
LPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVKD
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagaggatgagtgactcggcagacaagccgattgacaacgacgcagagggggtctgg
agtccggacattgagcagagtttccaggaggccctggctatctatccgccctgtgggagg
aggaaaatcatcttatcagacgaaggcaaaatgtatggtagaaatgaattgatagccaga
tacatcaaactgaggacgggaaagacaaggactaggaagcaggtgtctagtcacattcag
gttcttgccagaaggaaatctcgtgattttcattccaagctaaaggtaacaagcatggat
cagactgccaaggacaaggccctgcagcacatggctgccatgtcatcagcccagatcgtc
tcagctaccgccatccacaacaagctgggactgcctgggattccccgccccaccttccca
gggggcccggggttctggcctgggatgatacagacaggacagccaggatcctcacaagac
gtcaagccctttgtgcagcaggcctaccccatccagccagcagtcacagcccccattcca
gggtttgagcctgcatcagccccagctccctcagttcctgcctggcagggccgatccatt
ggcacaaccaagcttcgcctggtggaattctcagctttccttgagcagcagagagaccca
gactcgtacaacaaacacctcttcgtgcacatcgggcatgccaaccattcttacagcgac
ccgttgctcgaatccgtggacattcgtcagatatatgacaaatttcctgaaaagaaaggt
ggcttgaaagaactgtttggaaagggccctcaaaacgccttcttccttgtcaaattctgg
gcggacttaaactgcaatatccaagatgacgccggggccttttatggtgtgagcagtcaa
tacgagagttctgaaaacatgacagttacctgttccaccaaagtgtgctcctttgggaaa
caagtagtagaaaaagtagagacggagtatgcgaggttcgagaatggccgattcgtgtac
cgaataaaccgctcaccaatgtgtgaatatatgatcaacttcatccacaagcttaaacac
ctaccagagaaatatatgatgaacagcgttttggaaaacttcaccattttattggtggta
acaaacagggatacacaagagactctgctctgcatggcctgtgtgtttgaagtatcgaat
agtgagcatggagcacagcatcacatctacaggcttgtaaaggactga

DBGET integrated database retrieval system