KEGG   Rattus norvegicus (rat): 361640
Entry
361640            CDS       T01003                                 

Gene name
Polr3e
Definition
(RefSeq) DNA-directed RNA polymerase III subunit RPC5
  KO
K14721  DNA-directed RNA polymerase III subunit RPC5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    361640 (Polr3e)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    361640 (Polr3e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    361640 (Polr3e)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     361640 (Polr3e)
SSDB
Motif
Pfam: RPC5 RPC5_C zf-TFIIB
Other DBs
NCBI-GeneID: 361640
NCBI-ProteinID: NP_001101973
RGD: 1308086
Ensembl: ENSRNOG00000016960
UniProt: D3ZP45
Position
1
AA seq 708 aa
MANEEDDPVIQEIDVYLAKSLAEKLYLFQYPVRPASMTYDDIPHLSAKIKPKQQKVELEM
AIDTLNPNYCRSKGEQIALNVDGACTDETSTYSSKLMDKQTFCSSQTTSNTARYAAALYR
QGELHLTPLHGILQLRPSFSYLDKADAKHREREAANEAGDSSQDEAEEDVKQITVRFSRP
ESEQARQRRVQSYEFLQKKHAEEPWVHLHYYGMRDSRSEHERQYLLCQGSSGVENTELVK
SPSEYLMMLMPPSPEEEKDKPVAPSNVLSMAQLRTLPLADQIKVLMKNVKVMPFANLMSL
LGPSVDSVAVLRGIQKVAMLVQGNWVVKSDILYPKDSSSPHSGMPAEVLCRGRDFVMWKF
TQSRWVVRKEVAAVTKLCAEDVKDFLEHMAVVRINRGWEFLLPYDLEFIKKHPDVVQRQH
MLWSGIQAKLEKVYNLVKETMPKKPDGPSAPVVSGEQRVQTAKTKAQQNHAFLERELQRR
KEQIRGTTVLPSVQIKEEPLSEEEADGDELEAEEEEPMDTAPSSCLSTKLANGLPAGRAV
GGDSLNGHPIPGCASNPVARELKAFVEATFQRQFVLTLSELKRLFNLHLAGLPPGHTLFS
GVSDRMLQDTVLAAGCKQILVPFPPQTAASPDEQKVFALWESGDMSDQHRQVLLEIFSKN
YRVRRNMIQSRLTQECGEELSKQEVDKVLKDCCVSCGGMWYLKGTVQS
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggccaatgaagaagatgacccagtcatacaggagatcgatgtgtacttggccaaaagt
ctggcagagaagctgtatctctttcagtatcctgttcgtcctgcttcgatgacctatgat
gacattccacatctctcagccaagatcaagcccaaacagcagaaggttgagcttgagatg
gccatcgacaccctgaatcccaactactgccgcagcaaaggggagcagattgcattgaac
gtggatggtgcctgtactgacgagactagcacatattcctcaaagctgatggacaagcag
accttctgctcctcccagaccaccagcaacacggctcgttacgcggctgcactctacagg
caaggcgagctccacctgacgcctttacatggcatcctacagcttcggcccagcttctcc
taccttgataaggcagatgccaagcaccgagagagggaggcggccaatgaggcaggggat
tcttctcaggacgaggcagaagaagatgttaagcagatcacggtacggttctccaggcca
gagtcagagcaggctcgccagcgtcgcgtgcagtcctatgagttcttgcagaagaagcat
gcagaggaaccctgggtccacctacactactatggcatgagggatagccgctcagagcat
gagcgccagtacctgctgtgtcagggatccagcggggtagagaacacggagctcgtcaag
tcgcccagcgaatacctcatgatgctcatgccacccagcccggaggaggagaaggacaag
cccgtagctcccagcaatgtcctgtccatggcccagctgcgtacattgcccctggctgat
cagattaaagtcctgatgaagaacgtgaaagtcatgccttttgctaacctcatgagcctc
ctgggcccctctgtggactctgtggctgttctgcgtggcatccagaaggtggcgatgttg
gtccaaggaaactgggtggtgaaaagtgacatcctgtatcctaaggattcttccagccct
catagtggtatgcctgctgaggtgctctgcaggggccgagactttgtcatgtggaagttc
acacagagccgatgggtggtaagaaaggaggtggcagcagtgaccaaactctgcgctgag
gatgtgaaggactttctggaacacatggctgtagtgaggatcaacagaggctgggagttc
ttactgccttacgacctggagtttatcaagaagcatccagatgtggtccagcggcaacac
atgctgtggtcgggcatccaggccaaattagaaaaagtctataatctcgtaaaagaaacc
atgccaaagaagccggatggaccatcagcgcctgttgtctctggggaacagcgggtccaa
acagccaaaaccaaggcccagcagaaccatgctttcttggagcgtgagctgcagcgacgg
aaggagcagattcggggaaccacagtcctgcccagcgtgcagatcaaggaggaacccctg
agtgaggaggaagccgatggggatgagctggaggctgaggaagaagaacccatggacact
gcacccagtagttgcctcagcaccaagttggccaatgggctgcctgctgggcgggcagtg
ggtggggacagcctaaatgggcacccaattccaggctgtgccagcaacccggttgcccgg
gaactgaaggcttttgtggaagccacctttcagagacagtttgtgctcacgttgagcgaa
ctcaagcgcctcttcaacctgcacctggcaggcctgcccccgggccacacactcttcagt
ggtgtctcagaccgaatgctacaggatacggtgctggccgctggctgcaagcagatactg
gtgccttttcccccacagactgctgcttcccctgatgagcagaaggtatttgccctctgg
gagtctggagacatgagtgaccagcatcgacaggttttgcttgaaatattttccaaaaat
taccgagtacgtcggaatatgatccagtctcggctgactcaagaatgtggagaagagcta
agcaagcaggaggtggataaagtgctaaaggactgttgtgtaagctgtggtggcatgtgg
taccttaaggggacagtacaatcctga

DBGET integrated database retrieval system