KEGG   Rattus norvegicus (rat): 361649
Entry
361649            CDS       T01003                                 

Gene name
Atxn2l, RGD1565868
Definition
(RefSeq) ataxin 2-like
  KO
K23625  ataxin 2/2L
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    361649 (Atxn2l)
   05017 Spinocerebellar ataxia
    361649 (Atxn2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    361649 (Atxn2l)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     361649 (Atxn2l)
SSDB
Motif
Pfam: SM-ATX LsmAD PAM2 LSM14
Other DBs
NCBI-GeneID: 361649
NCBI-ProteinID: NP_001123569
RGD: 1565868
Ensembl: ENSRNOG00000018686
UniProt: B3DMA1
Position
1q36
AA seq 1072 aa
MLKPQPPQQTSQPQQPPPTQQAVARRPPGGTSPPNGGLPGPLPATAAPPGPPTVVSPCLG
PAAAAGSGLRRGAESILAAPAPQQHQERPGAVAIGSVRGQTTGKGPPQSPVFEGVYNNSR
MLHFLTAVVGSTCDVKVKNGTTYEGIFKTLSSKFELAVDAVHRKASEPAGGPRREDIVDT
MVFKPSDVLLVHFRNVDFNYATKDKFTDSAIAMNSKVNGEHKEKVLQRWEGGDSNSDDYD
LESDMSNGWDPNEMFKFNEENYGVKTTYDSSLSSYTVPLEKDNSEEFRQRELRAAQLARE
IESSPQYRLRIAMENDDGRTEEEKHSAVQRQGSGRESPSLVSREGKYIPLPQRVREGPRG
GVRCSSSRGGRPGLSSLPPRGPHHLDNSSPGPGSEARGINGGPSRMSPKAQRPLRGGKTL
SSPNNRPSGEASVPPTSAVGRMYPPRSPKSAAPAPVSASCPEPPIGSAVASSASIPVTSS
VVDPGAGSISPASPKLSLAPTDVKELPTKEPSRSLEAQELARIAGKVPGLQNEQKRFQLE
ELRKFGAQFKLQPSSSSETGLDPFPSRILKEEAKGKEKEVDGLLTSDPMGSPVSSKAESI
LDKEDKVPLAAVAGSEGPEQLQPPCPSQTGSPPVGLIKGDDKEEGPVTEQVKKSTLNPNA
KEFNPTKPLLSVNKSTSTPTSPGPRTHSTPSIPVLTAGQSGLYSPQYISYIPQIHMGPAV
QAPQMYPYPVSNSVPGQQGKYRGAKGSLPPQRSDQHQPASAPPMMQAAAAAAGPPLVAAT
PYSSYIPYNPQQFPGQPAMMQPMAHYPSQPVFAPMLQSNPRMLTSGSHPQAIVSSSTPQY
PSAEQPTPQALYATVHQSYPHHATQLHGHQPQPATTPTGSQPQSQHAAPSPVQAGQAPHL
GSGQPQQNLYHPGALTGTPPSLPPGPSAQSPQSSFPQPAAVYAIHPHQQLPHGFTNMAHV
TQAHVQTGVTAAPPPHPGAPHPPQVMLLHPPQGHGGPPQGAVPPSGVPALSASTPSPYPY
IGHPQGEQPGQAPGFPGGADDRIREFSLAGGIWHGRAEGLQVGQDARVLGGD
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgttgaagcctcagccgccacaacagacctcccagccccagcagccgccccccacgcaa
caggccgtggctcgccggcctcccggcgggactagccctcccaacggcggcctcccggga
ccgctgcccgctaccgcggctcccccggggcctcccacagtggtctctccgtgcctgggg
cctgcagccgctgccggcagcgggctccgccgcggagccgaaagcatcttggcggcgcca
gcgccgcagcagcatcaagaacggccaggggcagtggctatcggcagcgtcaggggacag
accaccggaaagggacccccacagtcaccagtgtttgaaggtgtctataacaattccagg
atgctgcatttcctgacagctgtagtgggttctacctgtgatgtaaaagtgaaaaatggc
accacttatgagggcattttcaagacgctgagctcaaagtttgaactggcagtagatgcg
gtacatcggaaagcctctgagccagcaggtgggcctcgtcgggaagacattgtggacacc
atggtgtttaaaccaagtgatgttctgcttgtccacttccgaaatgttgacttcaattat
gctactaaagacaagttcactgactcagccattgccatgaactctaaggtgaatggagaa
cacaaagagaaggtgcttcagcgttgggagggcggtgacagcaacagtgatgactacgat
ctggaatccgatatgtctaatggatgggatcctaatgagatgttcaaatttaatgaggag
aactatggagtgaagaccacctatgacagcagtctatcttcttacacggttcccttagaa
aaggacaactctgaagagtttcggcagcgggagcttcgcgcggcccagttggctcgggag
attgagtctagtccccagtaccgtctacggattgccatggaaaatgacgacgggcgaacc
gaggaggagaagcacagtgcagttcagcggcaggggtccgggcgggagagccccagcttg
gtgtccagggaagggaaatatatccctctgcctcaacgagttcgggaaggtccccgggga
ggagttcgatgcagcagttctcgaggagggcggcctggccttagctctttgccacctcgt
ggccctcaccatcttgacaacagcagtcctggtcctgggtctgaggcacgtggtatcaat
ggaggtccttcccgcatgtcccccaaggcacagcggcctctgagaggtggcaagacctta
tcttcacccaacaataggccttctggagaagcttctgttcctccaacatctgcagtgggc
cggatgtaccctccacggtctcccaagtctgctgcccctgccccagtctcagcttcctgt
cctgagcctcccattggttcagcagtagcatcctctgcctccatccctgtgacatcatca
gttgtggatcctggagcaggctctatttccccagcatctccaaaactctccctggcccct
acagatgtaaaagaactcccaaccaaggagcccagtaggagtttggaagcccaagagctg
gcccgcatagctgggaaagtccctggccttcagaatgaacaaaaacgctttcagttggaa
gaactgaggaaatttggggcccagtttaagcttcaacctagtagctcctctgagacgggc
ctggatccatttccttcccggatcttgaaagaagaggccaaaggaaaggagaaagaagtg
gatggtctattgacttcagatcctatgggatccccagtctcctccaaggcagaatccata
ttggataaggaagacaaagtgcccctggcagcagtagcggggtctgaggggccagaacag
ctccaaccaccttgccccagccaaactggcagtcctccagtgggcctcatcaagggagat
gacaaagaggagggcccggttactgaacaagtaaagaagtctactttgaaccccaatgcc
aaggagttcaatccaacaaagcctctgctgtctgtgaacaaatctaccagtactccaact
tcaccagggccccgtactcattcaacaccttccataccggtgctgacagcaggccagagt
gggctctacagtccccagtacatctcatatatacctcagatccacatgggaccagctgtg
caggcacctcagatgtatccatatcctgtatccaattcggtgcctgggcagcagggcaag
taccggggtgcaaaaggctcacttcccccccagcgctctgaccaacaccaaccagcctca
gcccctccaatgatgcaggctgctgctgctgctgctggcccacccttggtggctgccaca
ccttattcctcctacatcccttacaacccacagcagttcccaggccagcctgccatgatg
cagcccatggcacactacccttcacagccggtgttcgcccctatgcttcaaagtaatcca
cgaatgttgacatcgggaagccatccccaggccatcgtgtcatcctccactcctcagtac
ccttctgcagagcagcctaccccccaagccctttatgccactgttcaccagtcctatcca
caccatgccacgcagctccatggccaccagcctcagccggccaccactcctactgggagc
caaccacaatcccagcatgcggcccccagtcccgttcaggcggggcaggccccacacctg
ggcagtggacaaccacagcagaatctgtaccatccaggggccctaacaggcacgccacct
tctctaccaccgggaccttctgcccagtcccctcaaagcagcttcccccagccagctgct
gtgtatgccatccatccccaccagcagctgccccacggcttcaccaacatggcccatgtt
acccaggcccatgtccaaactggagtcacagcagccccgcccccacaccctggggctccc
cacccgccccaggtgatgctgctgcaccccccccagggccatgggggccccccccaaggc
gcggtgcccccgagtggggtgcctgcactctcagcttccacaccctcaccctacccctac
atcggacacccccaaggtgagcagcctggccaggcgcctggatttccaggaggagccgat
gacaggattcgtgagttctcgttagctgggggaatttggcatggaagagctgaggggctg
caggtggggcaggatgcacgggttctgggtggggattga

DBGET integrated database retrieval system