KEGG   Rattus norvegicus (rat): 361659Help
Entry
361659            CDS       T01003                                 

Gene name
Plekha1, RGD1564153
Definition
(RefSeq) pleckstrin homology domain containing A1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_8 PH_11 Mcp5_PH PH_9
Motif
Other DBs
NCBI-GeneID: 361659
NCBI-ProteinID: NP_001073363
RGD: 1564153
Ensembl: ENSRNOG00000020497
UniProt: A1A5P7
Position
1q41
AA seq 335 aa AA seqDB search
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIK
LTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSD
SQPASDNLSRQGDCGKKQVSYRTDIVGGVPIITPTQKEEVNECGESVDRNNLKRSQSHLP
YFAPKPPADSAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEV
HKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQRGPGRSSSS
SMRQARRLSNPCIQRYTSRAGECSTYVGSHANVPS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccttatgtggatcgacagaatcgcatctgtggttttctagacattgaggaaaatgag
aacagcgggaaatttcttcgacggtatttcatcctggataccagagaggacagctttgta
tggtacatggataatccacagaacctgccttcaggatcatcacgggttggagccattaaa
cttacctacatttcaaaggttagcgatgcgactaagttaaggccaaaggcagagttttgt
tttgttatgaatgcaggaatgagaaaatactttctacaagctaatgatcagcaggactta
gtggagtgggtaaatgtcttgaacaaagctataaaaattacagtaccaaagcagtcagac
tcacagccggcctctgataacctgagtcgccaaggtgactgtggcaagaagcaagtgtct
tacagaactgatattgttggtggtgtacccatcatcactccaacacagaaagaagaagta
aacgaatgtggtgagagtgtcgacagaaacaatttgaaacggtcacaaagccatcttcct
tactttgctcctaagccacctgcagacagtgcagtcatcaaagctgggtattgtgtgaaa
caaggagcggtgatgaaaaactggaagagaaggtattttcagctggatgaaaacacaata
ggctacttcaagtctgaactggaaaaggagcctctgcgggtaataccacttaaagaagtt
cacaaagtccaagagtgcaagcaaagtgacattatgatgagggacaacctgtttgaaatc
gtgacaacgtctcggactttctatgtgcaggctgatagccctgaggagatgcacagttgg
attaaagcagtctctggagctattgtagcacagcggggaccgggcagatcatcatcatct
tctatgcggcaggccagaaggctgtcgaacccttgtatacagaggtatacgtcaagagct
ggcgaatgcagcacgtatgtgggctctcatgcaaatgtgccttcttag

DBGET integrated database retrieval system