KEGG   Rattus norvegicus (rat): 361659
Entry
361659            CDS       T01003                                 

Gene name
Plekha1, RGD1564153
Definition
(RefSeq) pleckstrin homology domain containing A1
  KO
K23796  pleckstrin homology domain-containing family A member 1/2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    361659 (Plekha1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   361659 (Plekha1)
SSDB
Motif
Pfam: PH PH_8 PH_11 PH_9 Mcp5_PH
Other DBs
NCBI-GeneID: 361659
NCBI-ProteinID: NP_001073363
RGD: 1564153
Ensembl: ENSRNOG00000020497
UniProt: A1A5P7
Position
1q41
AA seq 335 aa
MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIK
LTYISKVSDATKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSD
SQPASDNLSRQGDCGKKQVSYRTDIVGGVPIITPTQKEEVNECGESVDRNNLKRSQSHLP
YFAPKPPADSAVIKAGYCVKQGAVMKNWKRRYFQLDENTIGYFKSELEKEPLRVIPLKEV
HKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSWIKAVSGAIVAQRGPGRSSSS
SMRQARRLSNPCIQRYTSRAGECSTYVGSHANVPS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgccttatgtggatcgacagaatcgcatctgtggttttctagacattgaggaaaatgag
aacagcgggaaatttcttcgacggtatttcatcctggataccagagaggacagctttgta
tggtacatggataatccacagaacctgccttcaggatcatcacgggttggagccattaaa
cttacctacatttcaaaggttagcgatgcgactaagttaaggccaaaggcagagttttgt
tttgttatgaatgcaggaatgagaaaatactttctacaagctaatgatcagcaggactta
gtggagtgggtaaatgtcttgaacaaagctataaaaattacagtaccaaagcagtcagac
tcacagccggcctctgataacctgagtcgccaaggtgactgtggcaagaagcaagtgtct
tacagaactgatattgttggtggtgtacccatcatcactccaacacagaaagaagaagta
aacgaatgtggtgagagtgtcgacagaaacaatttgaaacggtcacaaagccatcttcct
tactttgctcctaagccacctgcagacagtgcagtcatcaaagctgggtattgtgtgaaa
caaggagcggtgatgaaaaactggaagagaaggtattttcagctggatgaaaacacaata
ggctacttcaagtctgaactggaaaaggagcctctgcgggtaataccacttaaagaagtt
cacaaagtccaagagtgcaagcaaagtgacattatgatgagggacaacctgtttgaaatc
gtgacaacgtctcggactttctatgtgcaggctgatagccctgaggagatgcacagttgg
attaaagcagtctctggagctattgtagcacagcggggaccgggcagatcatcatcatct
tctatgcggcaggccagaaggctgtcgaacccttgtatacagaggtatacgtcaagagct
ggcgaatgcagcacgtatgtgggctctcatgcaaatgtgccttcttag

DBGET integrated database retrieval system