KEGG   Rattus norvegicus (rat): 361663
Entry
361663            CDS       T01003                                 
Symbol
Lhpp
Name
(RefSeq) phospholysine phosphohistidine inorganic pyrophosphate phosphatase
  KO
K11725  phospholysine phosphohistidine inorganic pyrophosphate phosphatase [EC:3.6.1.1 3.1.3.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    361663 (Lhpp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    361663 (Lhpp)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     361663 (Lhpp)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     361663 (Lhpp)
Protein phosphatases and associated proteins [BR:rno01009]
 HAD phosphatases
  Other HAD phosphatases
   361663 (Lhpp)
SSDB
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase HAD_2
Other DBs
NCBI-GeneID: 361663
NCBI-ProteinID: NP_001009706
RGD: 1359187
Ensembl: ENSRNOG00000017097
UniProt: Q5I0D5
Position
1:187403390..187494577
AA seq 270 aa
MAAWAERLSGVRGVLLDISGVLYDSGTGGGAAIAGSVEAVARLKRSPLKVRFCTNESQKS
RRELVGVLQRLGFDISEGEVTAPAPATCQILKERGLRPHLLIHEGVRSEFDDIDMSNPNC
VVIADAGEGFSYQNMNRAFQVLMELENPVLISLGKGRYYKETSGLMLDVGGYMKALEYAC
GIEAEVVGKPSPEFFRSALQAIGVEAHQAIMIGDDIVGDVGGAQQCGMRALQVRTGKFRP
GDEHHPEVRADGYVDNLAEAVDLLLQHMDK
NT seq 813 nt   +upstreamnt  +downstreamnt
atggccgcgtgggctgagcggctgtcgggcgtacggggggtgctgcttgatatctccggc
gtgctgtatgacagcggcacaggcggcggagctgctattgcaggctctgtggaggcggtg
gcgagactgaaacggtccccgctgaaagtgagattctgcaccaatgagtcccagaagtcc
cggcgagagctggtgggggtgcttcagcggctggggtttgacatctcagaaggagaggtg
actgcccctgcgccagccacctgccagatcctgaaggagcgaggcctgcggccacactta
ctcatccatgaaggagtccgctcagaattcgatgacattgatatgtccaacccaaactgt
gtggtgattgcggatgctggggaaggcttttcctatcagaatatgaacagagccttccaa
gtgctgatggagctggaaaaccccgtgctcatatccctgggaaaaggacgctattacaag
gagacctctggcctgatgctggatgttggaggttacatgaaggcactcgagtatgcctgt
ggtatcgaggctgaagtggtggggaaaccctcccctgagttcttcaggtctgctctgcaa
gccataggggtggaagcccaccaggccatcatgattggcgatgacatcgtgggtgacgtt
ggcggtgcccagcagtgcggaatgagagctctgcaggtgcggaccgggaagttcaggcct
ggcgatgagcaccatccagaagtgagggcagatgggtacgtggacaaccttgcagaagcc
gtggacctgctgctgcagcacatggacaagtga

DBGET integrated database retrieval system