KEGG   Rattus norvegicus (rat): 361676
Entry
361676            CDS       T01003                                 

Gene name
Pnpla2, RGD1309044
Definition
(RefSeq) patatin-like phospholipase domain containing 2
  KO
K16816  patatin-like phospholipase domain-containing protein 2 [EC:3.1.1.3]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00561  Glycerolipid metabolism
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04923  Regulation of lipolysis in adipocytes
Module
rno_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    361676 (Pnpla2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    361676 (Pnpla2)
  09159 Environmental adaptation
   04714 Thermogenesis
    361676 (Pnpla2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     361676 (Pnpla2)
SSDB
Motif
Pfam: Patatin
Other DBs
NCBI-GeneID: 361676
NCBI-ProteinID: NP_001101979
RGD: 1309044
Ensembl: ENSRNOG00000018736
UniProt: P0C548
Position
1q41
AA seq 478 aa
MFPRETKWNISFAGCGFLGVYHIGVASCLREHAPFLVANATHIYGASAGALTATALVTGA
CLGEAGANIIEVSKEARKRFLGPLHPSFNLVKTIRGCLLKTLPADCHTRASGRLGISLTR
VSDGENVIISHFSSKDELIQANVCSTFIPVYCGLIPPTLQGVRYVDGGISDNLPLYELKN
TITVSPFSGESDICPQDSSTNIHELRITNTSIQFNLRNLYRLSKALFPPEPMVLREMCKQ
GYRDGLRFLRRNGLLNQPNPLLALPPVVPQEEDAEEAAVTEERTGGEDRILEHLPARLNE
ALLEACVEPKDLMTTLSNMLPVRLATAMMVPYTLPLESAVSFTIRLLEWLPDVPEDIRWM
KEQTGSICQYLVMRAKRKLGDHLPSRLSEQVELRRAQSLPSVPLSCATYSEALPNWVRNN
LSLGDALAKWEECQRQLLLGLFCTNVAFPPDALRMRAPASPTATDPATPQDPSGLPPC
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgttcccaagggagaccaagtggaacatctcgttcgctggctgcggcttcctcggggtc
taccacattggagtggcctcctgcctccgtgagcacgcgcccttcctggtggccaacgcc
actcacatctacggagcctcggcaggggcgcttaccgccacagcgctggtcactggggcc
tgcctgggcgaagcgggtgccaacattattgaggtgtccaaggaggctcggaagcggttc
ctgggtcccctgcacccctccttcaacctggtaaagaccatccgtggttgtctactgaag
accctgcctgctgattgccacacgcgtgccagcggacgcctgggcatctccctgactcga
gtttcggatggagagaatgtcatcatatcgcactttagctccaaggatgagcttatccag
gccaatgtttgcagcacttttatccctgtgtactgtggcctcattcctcctacccttcaa
ggggtgcgctatgtggatggcggcatttcagacaacttgccactttatgagctgaagaat
accatcacagtgtccccattctcaggcgagagtgacatctgcccacaagacagctccacc
aacatccacgaacttcgtatcaccaacaccagcatccaattcaacctgcgcaatctctac
cgcctctcgaaggctctcttcccgccagagcccatggttctccgagagatgtgcaaacag
ggctaccgagatggacttcgattccttaggaggaatggcctactgaaccaacccaaccct
ttgctggcactgcccccggttgtcccccaggaagaggatgcagaggaagctgccgtgact
gaggagaggactggaggggaggatcggattctagagcacctgcctgccagactcaacgag
gccctgctggaggcctgtgtggaaccgaaagacctgatgaccaccctttccaacatgctg
ccagtgcgcctggccactgccatgatggtaccctatactctgccactggagagcgcagtg
tccttcaccatccgtttgttggagtggctgcctgatgtccctgaggatatccggtggatg
aaggagcagacaggtagcatctgccagtatctggtgatgagggccaagaggaaattgggt
gaccatctaccttccagactgtctgagcaggtggagctgcggcgtgcccagtctctgccg
tctgtgccactgtcttgcgccacctacagtgaggcactgcccaactgggtacgaaacaac
ctctcactgggggacgcgctggccaagtgggaagaatgccagcgtcagctactgctgggt
ctcttctgcaccaatgtggccttcccgcctgatgccttgcgcatgcgcgcacctgccagc
cccaccgccacagatcctgccaccccacaggatccatctggcctcccaccttgctga

DBGET integrated database retrieval system