KEGG   Rattus norvegicus (rat): 361686
Entry
361686            CDS       T01003                                 

Gene name
Osbpl5
Definition
(RefSeq) oxysterol binding protein-like 5
  KO
K20464  oxysterol-binding protein-related protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    361686 (Osbpl5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361686 (Osbpl5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    361686 (Osbpl5)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    361686 (Osbpl5)
Transporters [BR:rno02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   361686 (Osbpl5)
SSDB
Motif
Pfam: Oxysterol_BP PH
Other DBs
NCBI-GeneID: 361686
NCBI-ProteinID: NP_001015024
RGD: 1308402
Ensembl: ENSRNOG00000020713
UniProt: G3V8S8
Position
1q42
AA seq 898 aa
MALSILSEQFCIRRPRQKPPSTHTMKEEAFLRRRFSLCPPASTPQKTDPRKLPRNLLLGC
ENELGPITPGRDMESNGPSQPRDEEPLTPGSATKVPLAEYRLCNGSDKECTSPTTRVSKK
DTLKAQKENYRQEKKRATKQLFSALTDPSVVIMADSLKIRGTLKSWTKLWCVLKPGVLLI
YKTPKVGQWVGTVLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVKGPKGETVGSITQPL
PSSYLIFRAASESDGRCWLDALELALRCSSLLRLSTCKQGRDGEQGSSPDASPSSLYGLP
TSATIPDQDLFPLNGSALENDAFSDKSERENADDSDAETQDHSRKTNESGSDLLDSPGGP
RRGTTYVEQVQEELGELDETSQVETVSEENKSLMWVLLRQLRPGMDLSRVVLPTFVLEPR
SFLSKLSDYYYHGDLLSRAAAEDDPYCRIKLVLRWYLSGFYKKPKGIKKPYNPILGETFR
CCWLHPQTNSHTFYIAEQVSHHPPVSAFYVSNRKDGFCMSGSITAKSKFYGNSLSALLDG
KAKLTFLNRKEEYTLTMPYAHCRGLLYGTMTMELGGKVTIQCEKNNLQAELDFKLKPFFG
SSTSINQISGKITSGEEVLARLTGHWDRDVFIKEEASGGTKLFWTPSEEVRRQRLKRHTV
LLEEQSELESERLWQHVTRAIHEGDQHKATQEKSVLEEAQRQRAREHQQSLTPWKPQLFT
LDPLTQEWRYQYEDYSPWDPLKDIAQYEQDGILHTLQRETMSGQTAFLGSPESRHKRPSS
DRRLRKASDQPSGHSQVTESSGSTPESCPDLSDEDFVPGNESPCPRCRREVHRLRMLQEA
VLSIQEAQQELHRHLSAMLRSTVRAGQAPAPGLLQNPRSWFLLCIFLTCQLFINYILK
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggccctgagcatcttgtctgagcagttctgcatccgaaggcctcgccagaagcccccc
agcacccacaccatgaaggaggaggcctttctccggcgccgtttctcgctatgtccgcca
gcttctactccgcagaagactgacccccggaaactcccacggaacctgcttctgggctgt
gaaaatgagcttggtcccatcaccccaggaagggacatggagtccaacggcccatcacaa
cccagagatgaagagcccctgacaccaggctccgccacgaaggtgccactggccgagtac
aggctatgcaatggatctgacaaggaatgtacctctccaacgaccagggtctccaagaag
gacacgctcaaggcacagaaggagaattaccggcaggagaagaagcgggccacaaagcag
cttttcagtgccctgactgaccccagcgtggtcatcatggctgacagtctgaagatccgg
gggaccctgaagagctggacgaagctgtggtgtgtgctgaagcctggggtgctgctcatc
tacaagacacccaaggtgggccagtgggtgggcacggtgctgctgcactgttgtgagctt
atcgagcgcccctccaagaaggatggcttctgcttcaaactcttccacccgctggaccag
tctgtgtgggctgtgaagggccccaagggcgagactgtgggctccatcacacagcctctc
ccgagcagctacctgatcttcagggcagcttctgaatcagacggccgctgctggctagat
gccctggagctggcccttcgctgctccagcctgcttcgactgagcacatgcaagcagggc
cgagatggggagcaggggtcttcacctgatgcctctccctcttccctctacggactgccc
acctcggccaccatcccagaccaagacctgttcccgttaaatgggtcagccttggagaat
gacgcgttctcagacaagtcagagagagagaatgctgacgactcagatgctgagacccag
gatcacagccgcaagaccaatgagagtgggagtgacctgctggacagccctggtgggcca
cggaggggaaccacgtatgtagagcaggtccaggaggagctgggagagctggacgagacg
tcccaggtggagacagtgtcagaggagaacaagagcctgatgtgggtgctgctgcgacag
ctgcggccgggcatggacctgtcacgtgtggtgctgccgaccttcgtgttggagcctcgg
tccttcctcagcaagctctctgattactactaccatggagacctgctctccagggcagca
gcagaggatgacccctactgccgcatcaagcttgtgctacggtggtacctgtctggcttc
tacaaaaagcccaagggcatcaagaaaccctataatcccattctgggggagacttttcgc
tgctgctggctgcaccctcagaccaacagtcacaccttctacatagcagaacaggtgtct
caccatcctccagtgtctgccttctacgtcagcaacaggaaagatggcttctgcatgagc
ggcagcatcacagccaagtcgaagttctacgggaactctctgtcagcgcttctggatggc
aaggctaagctcacctttttgaaccgcaaggaggagtacaccctcaccatgccctatgcc
cactgccgagggctcctgtacggcaccatgaccatggagctgggaggtaaagtgaccata
cagtgtgagaagaacaatctccaagctgaactggacttcaaactcaagcctttctttggg
agcagcaccagcatcaaccagatttctgggaagatcacatcaggggaggaagtcctggcc
cgcctcactggacactgggacagagatgtatttatcaaggaagaggccagtggaggcacc
aagctcttctggactcctagtgaggaggtccgcaggcagcggctgaagcggcacacggtg
ctgttggaagagcagagtgaactggagtctgagaggctctggcagcatgtcaccagggcc
atccatgagggtgaccagcacaaagccacccaggagaagtctgtgctggaagaggcgcag
cggcagcgtgcccgtgagcaccagcagagcctcactccatggaagccacagttgttcacc
ctggacccactcactcaggaatggcgctaccaatatgaggactacagcccttgggacccg
ctaaaggacattgcccaatatgagcaagatgggattcttcacactctacagagggagact
atgtctggacagacagccttcctgggaagtccagagtccaggcacaagaggcctagctct
gaccggcggctccgcaaagccagtgaccagccctctggccatagccaggtcactgagagc
agcggctccacacctgagtcctgcccagacctctctgatgaggactttgttcctggtaat
gagagcccgtgtcctcggtgcaggcgagaggtacaccggctaaggatgctacaagaggca
gtgctgtccattcaggaagctcagcaagagctgcatcggcacctttcagccatgttgaga
tccacagtgcgtgctgggcaggcgccggcccccggcctcctgcagaatccccgctcctgg
ttcctgctttgcatcttcctgacatgtcagctattcattaactatatcctcaaataa

DBGET integrated database retrieval system