KEGG   Rattus norvegicus (rat): 361696
Entry
361696            CDS       T01003                                 

Gene name
Rps6kb2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04066  HIF-1 signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04350  TGF-beta signaling pathway
rno04371  Apelin signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04931  Insulin resistance
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    361696 (Rps6kb2)
   04350 TGF-beta signaling pathway
    361696 (Rps6kb2)
   04371 Apelin signaling pathway
    361696 (Rps6kb2)
   04066 HIF-1 signaling pathway
    361696 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    361696 (Rps6kb2)
   04152 AMPK signaling pathway
    361696 (Rps6kb2)
   04150 mTOR signaling pathway
    361696 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    361696 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    361696 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    361696 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    361696 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    361696 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    361696 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    361696 (Rps6kb2)
   05205 Proteoglycans in cancer
    361696 (Rps6kb2)
   05231 Choline metabolism in cancer
    361696 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    361696 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    361696 (Rps6kb2)
   05212 Pancreatic cancer
    361696 (Rps6kb2)
   05225 Hepatocellular carcinoma
    361696 (Rps6kb2)
   05226 Gastric cancer
    361696 (Rps6kb2)
   05221 Acute myeloid leukemia
    361696 (Rps6kb2)
   05224 Breast cancer
    361696 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    361696 (Rps6kb2)
   05163 Human cytomegalovirus infection
    361696 (Rps6kb2)
   05165 Human papillomavirus infection
    361696 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    361696 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    361696 (Rps6kb2)
   01522 Endocrine resistance
    361696 (Rps6kb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    361696 (Rps6kb2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     361696 (Rps6kb2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   361696 (Rps6kb2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal ABC1 Seadorna_VP7 DUF6499
Other DBs
NCBI-GeneID: 361696
NCBI-ProteinID: NP_001010962
RGD: 1305144
Ensembl: ENSRNOG00000021689
UniProt: D4AE24
Position
1
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEPEFNPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPE
RIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEI
LVRIGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLA
KKFLKRNPTHRIGGGPGDAADVQRHPFFRHINWDDLLAHRVDPPFRPSLQSEEDVSQFDV
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPSLPPLLPPPSSPPPTSTAPLPIRPPSGTKKSKKGR
GRPGR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatttagacttggagaccgaggaaggaagtgagggcgagggcgag
ccggagttcaaccctgcggacgtgtgtccccttggcgagttaagggctgctggcctggag
acagtgggacactatgaggaggtggaactgacagagagcagcgtcaacctgggtcctgag
cgcatcggaccccactgctttgagctactgagtgttctgggcaaggggggttatggcaag
gtgttccaggtgagaaaagtgcaaggcaccaacttgggcaaaatatatgccatgaaagtc
ttgagaaaggccaagattgtatgcagtgccaaggacacagcacatacccgggctgagcgg
aacattctagaatcggtgaagcaccccttcattgtagaactggcctatgctttccagaca
ggtggcaaactctacctcatcctggagtgcctcagtggtggtgagctcttcacacatctt
gagcgagaaggcatcttcctggaagacacagcctgcttctacctggcagagatcacacta
gccctgggccatctccattcccaaggcatcatctaccgggatctcaagcccgagaacatc
atgctcaacagccagggccatatcaaactgacagactttggactctgcaaagagtccatt
catgagggtgctatcactcacaccttctgtggcaccattgagtacatggccccagagatt
ctagtgcgcatcggtcacaaccgggcagtggactggtggagcctgggagccctgatgtac
gacatgctcactggatcgccgcccttcaccgcagagaaccggaagaaaactatggataaa
atcattaaagggaagctggtgctgcccccctacctcaccccggatgcccgggaccttgcc
aaaaagtttctgaagcggaatcccactcatcgaattgggggtggcccaggagatgctgct
gatgtgcagaggcacccgtttttccggcacatcaattgggatgacctcttggcccatcgt
gtagaccctcccttcagaccgagtctgcaatcagaagaggacgtgagccagtttgatgtg
cgattcacacggcagacgccagtagatagtccagatgacacagccctcagtgagagtgcc
aaccaagccttcctgggcttcacgtatgtggcaccttctgtactggacagcatcaaagag
ggcttctccttccagcctaagctgcgctcccccagacgccttaacagcagtccccgcacc
cctatcagccccctcaagttctctccctttgaggggttccggcccagtcctggcccacca
gagcccatggagccatctctacctccactcctgccaccaccatcatcaccaccacccaca
agtactgccccacttcccatccgtcccccctcaggaaccaagaagtccaagaagggacgg
ggccgccctgggcgctag

KEGG   Rattus norvegicus (rat): 83840
Entry
83840             CDS       T01003                                 

Gene name
Rps6kb1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04066  HIF-1 signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04350  TGF-beta signaling pathway
rno04371  Apelin signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04931  Insulin resistance
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    83840 (Rps6kb1)
   04350 TGF-beta signaling pathway
    83840 (Rps6kb1)
   04371 Apelin signaling pathway
    83840 (Rps6kb1)
   04066 HIF-1 signaling pathway
    83840 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    83840 (Rps6kb1)
   04152 AMPK signaling pathway
    83840 (Rps6kb1)
   04150 mTOR signaling pathway
    83840 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    83840 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    83840 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    83840 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    83840 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    83840 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    83840 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83840 (Rps6kb1)
   05205 Proteoglycans in cancer
    83840 (Rps6kb1)
   05231 Choline metabolism in cancer
    83840 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    83840 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    83840 (Rps6kb1)
   05212 Pancreatic cancer
    83840 (Rps6kb1)
   05225 Hepatocellular carcinoma
    83840 (Rps6kb1)
   05226 Gastric cancer
    83840 (Rps6kb1)
   05221 Acute myeloid leukemia
    83840 (Rps6kb1)
   05224 Breast cancer
    83840 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    83840 (Rps6kb1)
   05163 Human cytomegalovirus infection
    83840 (Rps6kb1)
   05165 Human papillomavirus infection
    83840 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    83840 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    83840 (Rps6kb1)
   01522 Endocrine resistance
    83840 (Rps6kb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    83840 (Rps6kb1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     83840 (Rps6kb1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   83840 (Rps6kb1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal ABC1 APH
Other DBs
NCBI-GeneID: 83840
NCBI-ProteinID: NP_114191
RGD: 620683
Ensembl: ENSRNOG00000003919
UniProt: P67999
Position
10
AA seq 525 aa
MRRRRRRDGFYPAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVERPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgcctgacttccgacacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggatgcaggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagagcggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagaggggatattcatggaagatacagcttgcttttacttggct
gaaatctccatggctttggggcatttacatcaaaaggggattatctacagagacctgaag
ccggagaacatcatgcttaatcaccaaggtcacgtgaagctgacagactttggactatgc
aaagaatctattcatgatggaacagtcacgcacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagcggccacaaccgtgctgtggattggtggagtctggga
gcattaatgtatgacatgctgactggagcacctccattcactggggagaatagaaagaag
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
cgagatctgcttaaaaagctgctgaagagaaatgctgcttctcgtcttggagctggccct
ggggatgctggagaagtccaagcgcatccattttttagacacattaactgggaagagctt
ttggctcggaaggtggagcgcccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttactcgtcagacacctgttgacagccccgatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcttttgaaccaaaaatccgatcgcctcgaagatttattggt
agcccacgaacgcctgtcagcccagtcaaattctctcctggggatttctggggacgaggt
gcttcagccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtgga
atagagcagatggatgtgacaacgagcggggaagcttcagcgccacttccaatccgacag
cccaactctgggccatacaaaaaacaagcttttcctatgatctccaaacggccagagcac
ctgcgtatgaatctatga

DBGET integrated database retrieval system